KEGG   Salinispora tropica: Strop_3430Help
Entry
Strop_3430        CDS       T00504                                 

Definition
(GenBank) beta-N-acetylhexosaminidase
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
stp  Salinispora tropica
Pathway
stp00511  Other glycan degradation
stp00520  Amino sugar and nucleotide sugar metabolism
stp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:stp00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Strop_3430
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Strop_3430
Enzymes [BR:stp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Strop_3430
Chaperones and folding catalysts [BR:stp03110]
 Intramolecular chaperones
  Others
   Strop_3430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_20 Glyco_hydro_20b Glycohydro_20b2 Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: ABP55861
JGI: Stro3430
UniProt: A4XAB2
Position
3937947..3939701
Genome map
AA seq 584 aa AA seqDB search
MHPTPATSPQQPEHRPAPATSGATGTVPATDGGTSIPTTSRPATAQPAAGELARLAAHEA
GTGLAPAPVRLGDVVPAPEQVRPDPRADFTLSADTTVRVSPEPDARAVAERLADLLRPAT
GYRLPITEAQHPELADDIALVLVQQPDLGPEGYRLDVTPTGVRISAATAAGLHHGIQTLR
QLLPATIESSTPVRAAWTLPGGSITDRPRFPYRGAMLDVARHFFGVDDVLRVIDHLTRYK
LNHLHLHLTDDQGWRIAVESRPRLTTIGAHTAVGGSPGGWYTPADYQRIVAYAGERHLTV
VPEIDLPGHTNAALTAYPELAPEGTTPVPYTGTDVGFSYLDPTNAQTYEFVADVLGEVAA
RTPGPFLHIGGDEAFAVKGAAYTGFVERAQRIVAEFGKTVVGWHQLAPAAHSEGRVLQWW
GTDGVDPTTADAVRRGARLILSPGNHAYLDMKYTSDTPIGHDWAGLIDVRRAYDWDPATR
VTEVPAEAVLGVEAPLWTESVTSLAEIEFMLLPRLPAIAELGWSPRATHDWAAFRTRLAG
HGPRWTAAGIAFHRSPEIPWPTTPADPPTAQVAPPAPRPRTGRG
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
gtgcaccccacccccgccacctcgccgcagcagccggagcaccggcccgcacccgcgacc
tcgggcgcgacgggcaccgtgccggccaccgacggcggcacgagcatcccgacgacgtcc
cgcccagcgaccgcccagccggcagcgggcgagctggcccggctggcggcccacgaagca
ggcaccggactcgcccccgccccggtccggctgggcgacgtggtgcccgcacccgaacag
gtgcgaccggatccccgcgccgacttcacactgtcggccgacacgacagtccgggtcagc
cccgaacccgacgcgcgggccgtcgccgaacgcctcgccgacctgctccggccggccacc
ggatatcggctcccgatcaccgaagcgcagcaccccgagctggccgacgacatcgcgctc
gtcctcgtgcagcagcccgacctcggccccgagggctaccgactcgacgtcacgccgacc
ggcgtccggatcagtgccgccacggcggccgggctccaccacggcatccaaaccctgcgc
cagctcctcccggccacgatcgagagcagcactccggtccgcgccgcctggacgctgccc
ggtggatcgatcaccgaccggccacgctttccgtaccggggcgccatgctcgacgtggcc
cgccacttcttcggggtcgacgacgtcctgcgggtgatcgaccatctcacccgctacaag
ctcaaccacctgcatctgcacctcaccgatgaccagggttggcggatcgcggtcgagtcc
cggccgcgactgaccacaatcggcgcccacacggcggtcggtggctcccccggcgggtgg
tacaccccggccgactaccagcggatcgtcgcgtacgcgggcgagcggcacctcaccgtc
gttccggagatcgacctgccggggcacaccaacgccgcgctgaccgcctacccggagctg
gccccggaggggaccacaccggtgccctacaccggcaccgatgtcggcttcagctacttg
gacccgaccaacgcacagacgtacgaattcgtcgccgacgtgctgggggaggtcgccgcg
cgcactcccgggccgttcctgcacatcggcggcgacgaggccttcgcagtaaagggagcg
gcgtacaccggattcgtcgagcgggcgcaacgcatcgtggccgagttcggcaagacggtg
gtgggctggcaccagctggctccggcagcccacagcgaggggcgggtactccagtggtgg
ggcaccgacggcgtcgacccgacgaccgccgacgcggtccgccgaggcgcccggctgatc
ctctcccccggcaaccacgcgtatctggacatgaagtacacctccgacaccccgatcggg
catgactgggctggcctgatcgacgtacggcgggcgtacgactgggatccggcgacccgg
gtgacggaggtgccggcggaggcggtgctgggcgtggaggccccgctctggaccgagtcg
gtcacctcgctggcggagatcgagttcatgctcctgccccggctgcccgccatcgcggag
ctgggctggtcaccgcgggccacccacgactgggcggcgttccgcacccggttggccggg
cacggaccccgctggacggcagccgggatcgccttccaccgctcccccgagatcccctgg
ccaacaacgcccgccgacccgccgacggcgcaggtcgcgccacccgcgccgcgtccccgt
accgggcggggatag

DBGET integrated database retrieval system