KEGG   Salinispora tropica: Strop_3430Help
Entry
Strop_3430        CDS       T00504                                 

Definition
beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
stp  Salinispora tropica
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:stp00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Strop_3430
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Strop_3430
Enzymes [BR:stp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Strop_3430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3937947..3939701
Genome map
AA seq 584 aa AA seqDB search
MHPTPATSPQQPEHRPAPATSGATGTVPATDGGTSIPTTSRPATAQPAAGELARLAAHEA
GTGLAPAPVRLGDVVPAPEQVRPDPRADFTLSADTTVRVSPEPDARAVAERLADLLRPAT
GYRLPITEAQHPELADDIALVLVQQPDLGPEGYRLDVTPTGVRISAATAAGLHHGIQTLR
QLLPATIESSTPVRAAWTLPGGSITDRPRFPYRGAMLDVARHFFGVDDVLRVIDHLTRYK
LNHLHLHLTDDQGWRIAVESRPRLTTIGAHTAVGGSPGGWYTPADYQRIVAYAGERHLTV
VPEIDLPGHTNAALTAYPELAPEGTTPVPYTGTDVGFSYLDPTNAQTYEFVADVLGEVAA
RTPGPFLHIGGDEAFAVKGAAYTGFVERAQRIVAEFGKTVVGWHQLAPAAHSEGRVLQWW
GTDGVDPTTADAVRRGARLILSPGNHAYLDMKYTSDTPIGHDWAGLIDVRRAYDWDPATR
VTEVPAEAVLGVEAPLWTESVTSLAEIEFMLLPRLPAIAELGWSPRATHDWAAFRTRLAG
HGPRWTAAGIAFHRSPEIPWPTTPADPPTAQVAPPAPRPRTGRG
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
gtgcaccccacccccgccacctcgccgcagcagccggagcaccggcccgcacccgcgacc
tcgggcgcgacgggcaccgtgccggccaccgacggcggcacgagcatcccgacgacgtcc
cgcccagcgaccgcccagccggcagcgggcgagctggcccggctggcggcccacgaagca
ggcaccggactcgcccccgccccggtccggctgggcgacgtggtgcccgcacccgaacag
gtgcgaccggatccccgcgccgacttcacactgtcggccgacacgacagtccgggtcagc
cccgaacccgacgcgcgggccgtcgccgaacgcctcgccgacctgctccggccggccacc
ggatatcggctcccgatcaccgaagcgcagcaccccgagctggccgacgacatcgcgctc
gtcctcgtgcagcagcccgacctcggccccgagggctaccgactcgacgtcacgccgacc
ggcgtccggatcagtgccgccacggcggccgggctccaccacggcatccaaaccctgcgc
cagctcctcccggccacgatcgagagcagcactccggtccgcgccgcctggacgctgccc
ggtggatcgatcaccgaccggccacgctttccgtaccggggcgccatgctcgacgtggcc
cgccacttcttcggggtcgacgacgtcctgcgggtgatcgaccatctcacccgctacaag
ctcaaccacctgcatctgcacctcaccgatgaccagggttggcggatcgcggtcgagtcc
cggccgcgactgaccacaatcggcgcccacacggcggtcggtggctcccccggcgggtgg
tacaccccggccgactaccagcggatcgtcgcgtacgcgggcgagcggcacctcaccgtc
gttccggagatcgacctgccggggcacaccaacgccgcgctgaccgcctacccggagctg
gccccggaggggaccacaccggtgccctacaccggcaccgatgtcggcttcagctacttg
gacccgaccaacgcacagacgtacgaattcgtcgccgacgtgctgggggaggtcgccgcg
cgcactcccgggccgttcctgcacatcggcggcgacgaggccttcgcagtaaagggagcg
gcgtacaccggattcgtcgagcgggcgcaacgcatcgtggccgagttcggcaagacggtg
gtgggctggcaccagctggctccggcagcccacagcgaggggcgggtactccagtggtgg
ggcaccgacggcgtcgacccgacgaccgccgacgcggtccgccgaggcgcccggctgatc
ctctcccccggcaaccacgcgtatctggacatgaagtacacctccgacaccccgatcggg
catgactgggctggcctgatcgacgtacggcgggcgtacgactgggatccggcgacccgg
gtgacggaggtgccggcggaggcggtgctgggcgtggaggccccgctctggaccgagtcg
gtcacctcgctggcggagatcgagttcatgctcctgccccggctgcccgccatcgcggag
ctgggctggtcaccgcgggccacccacgactgggcggcgttccgcacccggttggccggg
cacggaccccgctggacggcagccgggatcgccttccaccgctcccccgagatcccctgg
ccaacaacgcccgccgacccgccgacggcgcaggtcgcgccacccgcgccgcgtccccgt
accgggcggggatag

DBGET integrated database retrieval system