KEGG   Salinispora tropica: Strop_3526Help
Entry
Strop_3526        CDS       T00504                                 

Definition
(GenBank) Semialdehyde dehydrogenase, NAD - binding
  KO
K04073  acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
stp  Salinispora tropica
Pathway
stp00360  Phenylalanine metabolism
stp00362  Benzoate degradation
stp00620  Pyruvate metabolism
stp00621  Dioxin degradation
stp00622  Xylene degradation
stp00650  Butanoate metabolism
stp01100  Metabolic pathways
stp01120  Microbial metabolism in diverse environments
stp01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:stp00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Strop_3526
   00650 Butanoate metabolism
    Strop_3526
  Amino acid metabolism
   00360 Phenylalanine metabolism
    Strop_3526
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Strop_3526
   00622 Xylene degradation
    Strop_3526
   00621 Dioxin degradation
    Strop_3526
Enzymes [BR:stp01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Strop_3526
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh
Motif
Other DBs
NCBI-ProteinID: ABP55957
JGI: Stro3526
UniProt: A4XAK8
Position
complement(4042964..4043890)
Genome map
AA seq 308 aa AA seqDB search
MSVGVAVLGSGNIGTDLMIKVLRLSDSLRMVAMAGIDPDSDGLARARRLGVTTTAEGVAG
LVALPEFADVALVFDATSAGAHRHHDAVLRAHGRTVVDLTPAAVGPYVVPPVNLDEHLRE
TNVNMVTCGGQATVPIVAAVGRVTPVTYGEIVASIAAKSAGPGTRANIDEFTETTARAIE
VVGGAELGKAIIVLNPADPPLLMRDTVYCLCPDTDADRSAIAAAIADMVRAVQEYVPGYC
LKQDVQFDRVDSYLPALGRRLTGLQVSTFLEVSGAGHYLPTYAGNLDIMTSAALRTAERL
IARRAVTA
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgtcggggtggcagtactcggttccgggaatatcgggaccgacttgatgatcaaa
gttctgcggctcagcgacagcctgcggatggtcgccatggcgggtatcgacccggactcc
gatgggctggcccgggcccggcgactcggcgtcaccaccaccgccgagggggtggcgggg
ctcgtggcgctgcccgagttcgccgacgtggcgctggtcttcgacgccacctcggccggg
gcccaccgacatcacgacgccgtgctgcgtgcccacggtcggaccgtggtcgacctgacc
cccgcggcggtcgggccgtacgtggtaccgccggtcaatctcgatgagcacctgcgggag
accaacgtcaacatggtcacttgcggcgggcaggcgaccgtgccgatcgtcgccgccgtc
ggccgggtcaccccggtcacgtacggggagatcgtcgcctcgatcgccgcgaagtcggcc
gggccgggcacccgggccaacatcgacgagttcaccgagaccaccgcccgggcgatcgag
gttgtcggcggcgccgagctgggcaaggccatcatcgtgctcaacccagcggatccgccg
ctgctgatgcgggacaccgtgtactgcctctgtccggacaccgacgcggaccgaagcgcg
atcgccgcggccatcgccgacatggtccgtgccgtacaggagtatgtccccggttactgc
ctgaaacaggatgtgcagttcgaccgggtggacagctacctgccggcgctcggtcgacgc
ctcaccgggctgcaggtctcgaccttcctggaggtctcgggcgccgggcactacctgccc
acgtacgcgggaaacctggacatcatgacgtcggccgcgctgcgcaccgcggagcggctg
atcgcccggcgggcggtgacggcatga

DBGET integrated database retrieval system