KEGG   Salinispora tropica: Strop_3526Help
Entry
Strop_3526        CDS       T00504                                 

Definition
acetaldehyde dehydrogenase (EC:1.2.1.10)
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
stp  Salinispora tropica
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:stp00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Strop_3526
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Strop_3526
   00650 Butanoate metabolism
    Strop_3526
  Amino acid metabolism
   00360 Phenylalanine metabolism
    Strop_3526
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Strop_3526
   00622 Xylene degradation
    Strop_3526
   00621 Dioxin degradation
    Strop_3526
Enzymes [BR:stp01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Strop_3526
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4042964..4043890)
Genome map
AA seq 308 aa AA seqDB search
MSVGVAVLGSGNIGTDLMIKVLRLSDSLRMVAMAGIDPDSDGLARARRLGVTTTAEGVAG
LVALPEFADVALVFDATSAGAHRHHDAVLRAHGRTVVDLTPAAVGPYVVPPVNLDEHLRE
TNVNMVTCGGQATVPIVAAVGRVTPVTYGEIVASIAAKSAGPGTRANIDEFTETTARAIE
VVGGAELGKAIIVLNPADPPLLMRDTVYCLCPDTDADRSAIAAAIADMVRAVQEYVPGYC
LKQDVQFDRVDSYLPALGRRLTGLQVSTFLEVSGAGHYLPTYAGNLDIMTSAALRTAERL
IARRAVTA
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgtcggggtggcagtactcggttccgggaatatcgggaccgacttgatgatcaaa
gttctgcggctcagcgacagcctgcggatggtcgccatggcgggtatcgacccggactcc
gatgggctggcccgggcccggcgactcggcgtcaccaccaccgccgagggggtggcgggg
ctcgtggcgctgcccgagttcgccgacgtggcgctggtcttcgacgccacctcggccggg
gcccaccgacatcacgacgccgtgctgcgtgcccacggtcggaccgtggtcgacctgacc
cccgcggcggtcgggccgtacgtggtaccgccggtcaatctcgatgagcacctgcgggag
accaacgtcaacatggtcacttgcggcgggcaggcgaccgtgccgatcgtcgccgccgtc
ggccgggtcaccccggtcacgtacggggagatcgtcgcctcgatcgccgcgaagtcggcc
gggccgggcacccgggccaacatcgacgagttcaccgagaccaccgcccgggcgatcgag
gttgtcggcggcgccgagctgggcaaggccatcatcgtgctcaacccagcggatccgccg
ctgctgatgcgggacaccgtgtactgcctctgtccggacaccgacgcggaccgaagcgcg
atcgccgcggccatcgccgacatggtccgtgccgtacaggagtatgtccccggttactgc
ctgaaacaggatgtgcagttcgaccgggtggacagctacctgccggcgctcggtcgacgc
ctcaccgggctgcaggtctcgaccttcctggaggtctcgggcgccgggcactacctgccc
acgtacgcgggaaacctggacatcatgacgtcggccgcgctgcgcaccgcggagcggctg
atcgcccggcgggcggtgacggcatga

DBGET integrated database retrieval system