KEGG   Salinispora tropica: Strop_3871Help
Entry
Strop_3871        CDS       T00504                                 

Definition
bifunctional uroporphyrinogen-III synthetase/response regulator domain-containing protein (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
stp  Salinispora tropica
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:stp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Strop_3871
Enzymes [BR:stp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Strop_3871
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4433203..4434291
Genome map
AA seq 362 aa AA seqDB search
MRDELAGFTVGVTADRRRDELAALLQRHGARVVFAPALRIVPLADDTELRAATRACLDRP
PDVLMADTGIGMRGWLEAAEGWGLAEPLRTALREAYVVARGPKARGAIRAAGLHDQWSPA
SESCAEVVAHLRDRGVAGQVVAMQLHGGQQPECTQALVAAGATVIAVPVYRWAPPTDPAP
LHRLIDLVIDRMVDAVTFTSAPAAEALLRAAGDRVDQVLDAFRSAVLASCVGTVTAEPLR
RRGVPVSAPERARLGALVRTIVAELPRRAVTLKAAGHLLTLRGHAAVVDGELRPLAPAPM
AVLRTLSASPGRVLSRAALLRTLPRGADEHAVEMAVARLRAGLKAPGVVQTVVKRGYRLR
VD
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgacgaactggccggcttcaccgtcggggtgaccgccgaccggcgtcgggacgag
ttggcggcgttactccagcggcacggggcccgggtggtcttcgcacccgccctgcggatc
gtgccactcgccgacgacaccgagctgcgcgcggcgacgcgggcctgcctcgatcgacca
ccggacgtcctgatggccgacaccgggatcgggatgcggggctggctggaggcggccgag
ggctgggggctggctgagccgctgcgcacggcgctgcgcgaggcgtacgtggtggcgcgc
ggaccgaaggccaggggagcgatccgggccgccggcctgcacgaccagtggtcgcccgcc
tcggagagctgcgccgaggtggtggcgcacctgcgggaccgtggcgtggccggccaggtg
gtcgccatgcagctgcacggcggacagcaacccgagtgcacgcaggcgctggttgcggcc
ggagctaccgtgatcgcggtgccggtctaccgctgggccccgccgactgacccggcgcca
ctgcaccggctgatcgacctggtcatcgaccggatggtggacgcggtgacgttcacctcg
gcgccggctgccgaggcgttgctgcgcgccgccggggaccgggtcgaccaggtgctcgac
gcgttccggagcgcggtgctggcgagctgtgtgggaacggtgaccgcggagccgctgcgg
cggcggggggtaccggtcagcgcgcccgagcgggcccggctgggcgccctggtccgtacg
atcgtcgctgagttgccgcggcgcgcggtcaccctgaaggccgccggtcacctcctcacc
ctgcgtgggcacgccgcggtggtcgatggtgagctgcgaccgctggctccggcgccgatg
gcggtgctgcggacgctgtccgcgtccccggggcgggttctgtcccgcgcggcgctgctc
cggacgctgccgcgcggggcggacgaacacgcggtggagatggcggtggcgcggctgcgc
gctgggctgaaggctcccggggtggtgcagaccgtggtgaagcgcggctatcgcctccgc
gtcgactga

DBGET integrated database retrieval system