KEGG   Salinispora tropica: Strop_4307Help
Entry
Strop_4307        CDS       T00504                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
stp  Salinispora tropica
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:stp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Strop_4307
Enzymes [BR:stp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Strop_4307
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4878595..4879254)
Genome map
AA seq 219 aa AA seqDB search
MAASATEPDGDLDHVAARLVSGRLTGRPVEESVDLARLEKAVREILIAVGEDPDRDGLQQ
TPARVARAYAELLAGLRVDPAQVLTTTFEAGHDELVLVRDIDVMSLCEHHLLPFRGSAHI
GYIPGANGRITGLSKLARLVEVFARRPQVQERLTVQVADLLMAQLQPRGVIVVLECEHMC
MAMRGIQKSGACTITSAVRGSLQEDARTRAEAMALINSR
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
ttggccgcctccgctaccgagcccgacggcgacctggaccacgtcgccgctcggcttgtc
agcggccggctcaccggccgtccggtggaggagagcgttgacctggcccggctggagaag
gcggtccgcgagatcctgatcgcggtcggcgaagacccagaccgcgacgggctccagcag
accccggcccgggtcgcccgggcctacgccgagttgctcgccgggctccgcgtcgacccg
gcgcaggttctcaccaccaccttcgaggccggccatgacgagctggtgctggtccgggac
atcgacgtgatgagcctctgcgagcaccacctgctgccgttccgagggagcgcccacatc
gggtacattcccggcgcgaacggtcggatcaccggtctgtccaagctggcccggctggtg
gaggtcttcgcgcgtcgtccccaggtgcaggagcggctcaccgtgcaggtagccgacctg
ctgatggcgcagctccagccgcgcggcgtgatcgtcgtcctggagtgcgaacacatgtgc
atggcgatgcgcggtatccagaagtcgggtgcctgcacgattacctccgcggtacgcggc
agcctgcaggaggacgcgaggacccgcgccgaggcgatggccctgatcaactcgcgctga

DBGET integrated database retrieval system