KEGG   Salinispora tropica: Strop_4424Help
Entry
Strop_4424        CDS       T00504                                 

Definition
glycoside hydrolase family protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
stp  Salinispora tropica
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:stp00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5017208..5019337
Genome map
AA seq 709 aa AA seqDB search
MRRLFQALTVLAVTATAALVAAAPAQAATICEQYGTTTIQDKYIVQNNRWGSAAEQCIET
TNSGFRITSQQGSTSTSGPPLSYPSVVLGCHYQNCSPGTNLPAQLRQVSSVPSTISYGYA
GGTYNATYDIWMDPTPKTDGVSQMEIMIWFHRQGSIQPIGGPVGNTSVGGRNWEVWQGNN
GGNDVVSYLAPATINSWSFNVKDFIDDVVARTQVTNDWYLTSLQAGFEPWNGGVGLAVDN
FSADVNVGTNPPPPPGDGGTIVGQDSGRCLDILDLGTADGTPIQLWDCTANWNQLWNRTG
NTFVNPQTGKCLDVSGGSTANGARVQLYTCNGTGAQNWQVNGDGTITNPQSGKCLDAVEL
GTSNGTRIQIWECFGGGGTQPNQVWTVDGGTTPPGGDQTPLAANGQLYVCGVNLCNQHNQ
PIQLRGMSTHGLQWFNNCYNDAALNVLADEWKADLFRIAMYVQEGGYETNPPWFTNRVNE
LVDEAEERGLYAMIDFHTLTPGDPMYNLERAKTFFAAVASRNADKKHVIYEIANEPNGVG
WGTIKSYAEQVIPVIRANDPDAVVIVGTRGWSSLGVSEGANADEVINNPVNASNIMYAFH
FYAASHKDFYRAEVQRAAATLPLFVTEFGTVDYTGDGGVDVGSTNAWIDLLDQLKIGYAN
WTYSDANEGSGAFQSGTCNSGTFSGTSNLTVSGNLLRSRISTPDNFPTS
NT seq 2130 nt NT seq  +upstreamnt  +downstreamnt
atgagacgcctgttccaggcgctgaccgtactcgcggtcactgccaccgccgcgctcgtc
gccgcagcgccggcacaagccgcgacgatctgcgagcagtacggcaccaccaccatccag
gacaagtacatcgtccagaacaaccgctggggcagcgccgccgagcagtgcatcgaaacc
accaacagtggcttccgcatcacctcgcagcagggatccacctccacctccgggccgccg
ctctcctacccgtcggtggtgctcggatgtcactaccagaactgctcacccgggaccaac
ctgccggcacaactcaggcaggtcagcagcgttccgtccacaatcagctacgggtacgcg
ggcggcacctacaacgccacgtacgacatctggatggacccgactccgaagaccgacgga
gtgagccagatggaaatcatgatctggttccaccgacagggctcgatccagccgatcggc
ggcccggtcggcaacacctcggtggggggtcgtaactgggaggtctggcagggcaacaac
ggcggcaacgacgtggtctcctacctcgcaccggcgaccatcaacagctggtcgttcaat
gtcaaggacttcatcgacgacgtcgtcgcgcgcacccaggtcaccaacgactggtacctg
accagcctccaggccggcttcgaaccgtggaacgggggcgtcgggctggccgtcgacaac
ttctccgctgatgtgaacgtcggaacgaacccaccaccaccgccgggcgacggcggcacg
atcgtcggccaggacagcggacggtgcctggacatcctggacctcggcaccgccgacggt
accccgatccagctctgggactgcacggcgaactggaaccagctctggaaccgcaccggc
aacaccttcgtcaacccacagaccggtaagtgcctcgacgtctccggcgggtccaccgcc
aacggtgcccgggtgcagctctacacctgcaacggcaccggagcccagaactggcaggtc
aacggcgacggcaccatcaccaacccgcagtcgggcaagtgccttgacgcggtggagctg
ggaaccagcaacggcacccggatccagatctgggaatgcttcggcggcggcggcacccag
cccaaccaggtctggacggtcgacggcggcaccacgccaccgggtggcgaccagaccccg
ctggcggccaacggacagctgtacgtctgcggtgtgaacctgtgcaaccagcacaaccag
ccgatccagctgcgcggcatgagcacccacggcctgcagtggttcaacaactgctacaac
gacgccgcactcaacgtactggccgacgagtggaaagctgacctgttccgcatcgccatg
tacgtgcaggaggggggctacgagaccaacccaccgtggttcaccaaccgggtcaacgaa
ctcgttgacgaggctgaggagcgcggcctctacgccatgatcgactttcacacgctgacg
ccgggcgacccgatgtacaacctcgaacgggcgaagaccttcttcgccgccgtcgcttca
cgcaacgccgacaagaaacacgtcatctacgagatcgccaacgagcccaacggggtcggc
tggggcaccatcaagagctacgccgagcaggtcatcccggtgatccgggccaacgatccg
gacgccgtggtcatcgtcggcacccgcggctggtcctctctcggcgtctccgagggagcc
aacgccgacgaggtcatcaacaatccggtcaacgccagcaacatcatgtacgcgttccac
ttctacgccgcgtcccacaaggacttctaccgagccgaggtgcagcgtgcggcggcgacg
ttgccactgttcgtcaccgagttcggcaccgtcgactacaccggtgatggtggcgtcgac
gtgggcagcaccaacgcctggatcgacctgctcgaccagctgaagatcggctacgcgaac
tggacctactccgatgccaacgagggcagtggagcattccagtctgggacctgcaacagc
ggcaccttctccgggacatcgaacctcaccgtctccggcaatctcctccgcagccggatc
agcacccccgacaacttcccgacgagttga

DBGET integrated database retrieval system