KEGG   Salinispora tropica: Strop_4433Help
Entry
Strop_4433        CDS       T00504                                 

Definition
glyoxalase/bleomycin resistance protein/dioxygenase
Organism
stp  Salinispora tropica
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5027902..5028360
Genome map
AA seq 152 aa AA seqDB search
MSRVQLALRVSDLEGSIAFYSKLFDTEPAKRRPGYANFAVANPPLKLVLLEGEPDQPTAL
DHLGVEVPSTSEVDAATTRLVKSGLTTSEEKNTECCYALQDKVWVHGPGNEPWEVYTVKA
DSDQLQKATESACCTPTAAKEPVDSSNRTNCC
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgagtacagctcgcgctccgcgtctccgacctcgaaggctcgatcgccttctac
tcgaagctgttcgacaccgagccggccaagcgccgccccggctacgccaacttcgccgtg
gcgaacccaccgctgaagctcgtactcctggaaggcgagccggaccagcccaccgcgctg
gaccacctgggtgtcgaggttcccagtaccagtgaggtagacgccgcgaccacgcgactc
gtcaagtccggtctgaccacttcggaggagaagaacaccgagtgctgctacgcgctccag
gacaaggtctgggtacacggccccggcaacgagccgtgggaggtctacaccgtcaaggcc
gactccgaccaactccagaaggcgaccgagagcgcgtgttgcaccccgaccgcagcgaag
gagccggtggacagcagcaaccggacgaactgctgctga

DBGET integrated database retrieval system