KEGG   Salinispora tropica: Strop_4491Help
Entry
Strop_4491        CDS       T00504                                 

Definition
DNA-(apurinic or apyrimidinic site) lyase (EC:4.2.99.18)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
stp  Salinispora tropica
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:stp03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5081038..5081898
Genome map
AA seq 286 aa AA seqDB search
MPELPEVEALTVYLRQRAVGRRVDRLEISAINALKTYDPAITAAAGQPVVHAQRHGKFLD
LVLGADLHLVVHLARAGWLHFREEFSSRTPLRPGKGPVALRARLDDGSGFDLTEAGTQKS
LAVYLVTDPATVPGVARLGPDALAVDPATFADRLRSRKGQVKGVLTDQTVLAGVGNAYSD
EILHTARLSPFALTTRLTDEQLATLHAATRDVLGDAVSRSVGQRAAELKGEKRSGLRVHA
RTGLPCPVCGDTVREVSFADSSLQYCPGCQTGGKPLADRRLSRIVR
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
gtgcccgaactaccagaggtggaggcgctcaccgtctacctgcgccaacgcgccgtcggc
cgacgggtcgaccggctggagatctcggcgatcaacgccctgaagacgtacgacccggcg
atcacggccgcggccggccaaccggtcgtccacgcccagcgacacggcaagttcctcgac
ctggtgctcggcgctgacctgcacctggtcgttcacctggcccgcgccggctggctgcac
ttccgggaggagttctcgtcccgcaccccgctgcgccccggcaagggcccggtggcgctg
cgggcccgtctcgacgacggctccgggttcgacctgaccgaggccggcacccagaagagt
ctcgccgtctacctggtgaccgatccggcgacggtgcccggggtggcccgacttggtccg
gacgcgctcgccgtggacccggccaccttcgccgaccggctccgtagccgcaagggtcag
gtcaagggggtgctcaccgatcagacggtgctcgccggggtgggtaacgcgtactctgat
gagatcctgcacacggcgcgactgtcaccgttcgcgctgaccacccggctgaccgacgaa
caactcgccaccctgcacgcggccacccgggacgtgctcggcgacgcggtgtcccgatcg
gtggggcaacgggccgcggagctcaagggcgagaagcgctccggcctgcgggtgcacgcc
cgaaccgggttaccctgcccagtctgcggcgacacggtacgggaggtctcgttcgctgac
tccagcctccagtactgtccaggttgccagaccggcgggaagccactcgcggaccgacgg
ttgtctcgaattgtacggtga

DBGET integrated database retrieval system