KEGG   Spirochaeta thermophila DSM 6578: Spith_0029Help
Entry
Spith_0029        CDS       T02016                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
stq  Spirochaeta thermophila DSM 6578
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:stq00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Spith_0029
   01230 Biosynthesis of amino acids
    Spith_0029
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Spith_0029
   00030 Pentose phosphate pathway
    Spith_0029
   00051 Fructose and mannose metabolism
    Spith_0029
   00052 Galactose metabolism
    Spith_0029
  Energy metabolism
   00680 Methane metabolism
    Spith_0029
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Spith_0029
Enzymes [BR:stq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Spith_0029
Protein phosphatases and associated proteins [BR:stq01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Spith_0029
Messenger RNA biogenesis [BR:stq03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Spith_0029
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(27717..28817)
Genome map
AA seq 366 aa AA seqDB search
MKRPATRTFGILTSGGDCPGLNAAIRGVTKAAYWRYGMSIIGISHGYRGLIEGDARLLHP
RDFDGILTRGGTILGTSREKPFKPDPGEKDSEAGSRKVEAIIENYHKLHLDCLVVLGGNG
THKTAHLLQQAGLNVIGLPKTIDNDIWGTDVTFGFHSAVDIATEAIDRLHSTAHAHNRVM
VIEVMGHKAGWLALYAGIAGGGDIILIPEIPYDLAHIVHHLQTRQQRGKEFSIVVVAEGA
LSREESLMSKEERKKRRKKNRFPTKGYEVAHLIQEATGMETRVTVLGYLQRGGTPSPYDR
LLATRFGTAAAELLYRGDYGKMVALRDGEVVAIPLGEVAEKLKTVPPDHPLIDTARAVGT
CFGDGV
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtcccgcgacccgcaccttcgggatcctcacgagtgggggcgactgccccgga
ctcaacgccgccattcgaggcgtcaccaaggcagcctactggcggtacggcatgagcatc
atcggcatctcccacggataccgcggactcatagagggggacgcacggctccttcatcct
cgggacttcgacggcatcctcacgaggggcgggaccatcctcgggacttcccgggagaaa
cccttcaaacccgatcctggagagaaggattccgaagcggggagccggaaagtggaagcc
atcatcgagaactaccacaaactccacctcgactgtctggtggtcctgggaggcaacggc
acgcacaagaccgcccacctcctccaacaggcgggtctcaacgtcatcggacttcccaag
accatcgacaacgacatctggggcaccgacgtcaccttcggcttccacagtgccgtcgac
atcgccaccgaggccatcgatcgccttcactccacggcccacgcgcacaatcgggtcatg
gtgatcgaagtcatgggccacaaggcaggatggctcgccctctatgcagggatcgcaggg
ggcggggatatcatcctcatccccgagatcccctacgacctggctcacatcgtccaccac
ctccagacccgacagcaacgaggaaaggaattctccatcgtcgtggtcgcggaaggggcc
ctctcgcgcgaagagtcgctcatgtcaaaagaagagaggaaaaagaggcgcaagaagaac
cgcttccccaccaagggctacgaggtggcccacctcatccaggaagccaccggtatggag
acccgcgtcaccgtgctcggctatctccagcgcggagggacgccttcaccctacgatcgg
cttctcgccaccaggttcgggaccgcggccgcggaactcctctatcgaggcgactacggg
aagatggtggccctgcgggacggagaggtggtcgccatcccgctcggagaggtggcggaa
aaactgaagaccgtcccccccgaccatcccctcatcgacacggcccgtgcggtgggcacc
tgtttcggcgacggcgtgtag

DBGET integrated database retrieval system