KEGG   Spirochaeta thermophila DSM 6578: Spith_0051Help
Entry
Spith_0051        CDS       T02016                                 

Definition
UDP-N-acetylglucosamine1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
stq  Spirochaeta thermophila DSM 6578
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:stq00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Spith_0051
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Spith_0051
Enzymes [BR:stq01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     Spith_0051
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(50911..52185)
Genome map
AA seq 424 aa AA seqDB search
MRYRIEGGFPLKGTILAKGNKNAALPCIAACLLTDEEVVLENVPDIQDVRVMLDIVQYLG
VQVTRLRKDSYRLKTTDIVTSEIPQEKAKLIRASILFAGPLLARTGKAVLSPPGGDVIGR
RRLDTHFLALSALGARVEIDGVFRLTAHRLVGDEIFLDEASVTATENAIMAAVLAEGTTV
IRNAASEPHVQDLCHMLNQMGAQISGIGSNVLTIEGVERLSGTTFAIGSDYMEVGSFIGL
AAVTRGDVVIENADPQHLRMTKLAFGKLGIYWEQEGRTIHVPAGQSLKVVPDLGGAIPKI
DDAPWPGFPADLTSIMTVVATQAEGTILIHEKMFESRMFFVDKLIEMGARIILCDPHRAV
VSGPSRLRGSELTSPDVRAGMAMVIAALCAEGESLIHNVYQIERGYEDLVERLQHLGARI
RKES
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgagataccgaatcgaaggcggcttcccgctcaaaggcaccatcctcgccaaggggaac
aagaacgcagcactcccctgtatcgccgcctgtctcctcaccgacgaagaggtggtcctc
gagaacgtgcccgacatccaggacgtgagggtgatgctcgacatcgtccagtacctcggc
gtccaggtcacgcgccttcgtaaagactcctacaggctcaagaccaccgatatcgtcacc
tcagaaatccctcaagagaaggcgaagctcatccgggcctccatcctcttcgcaggcccc
ctcctggcccgtaccgggaaggcagtactctcaccccccggcggagacgtgatcggtcga
aggaggctcgacacccatttcctcgccctctccgccctgggcgcccgggtggagatcgac
ggcgtcttcaggctcacggcccacagactggtgggggacgagatcttcctggacgaggcc
tcggtgacggccaccgaaaacgccatcatggccgccgtgctcgccgaaggcaccaccgtg
atacggaacgcggcgtccgagccccacgtacaggacctctgccacatgctgaaccagatg
ggagcgcagatctcggggatcggttcgaacgtcctcaccatcgaaggagtggagcgcctc
tcgggtaccaccttcgccatagggtccgactacatggaagtgggttcgttcatcggactc
gcggccgtcaccaggggcgatgtggtcatagagaatgcagacccccagcacctcaggatg
accaaactcgccttcgggaagctcgggatctactgggaacaagaggggcgcaccatccac
gtgccggccgggcaatccctcaaggtggtgcccgatctgggaggggccattcccaagata
gacgatgccccgtggcccggattcccggccgacctcacgagcatcatgaccgtggtggcc
acccaggccgagggaaccatcctcatccacgagaagatgttcgagtcacgcatgttcttc
gtggacaaactcatcgagatgggcgcacgcatcatactctgcgacccccaccgcgccgtg
gtctcaggaccttcacggcttcggggctccgaactcacctcgcccgacgtacgggcaggg
atggccatggtgatcgccgccctctgtgcggaaggtgagagcctcatccacaacgtctac
cagatagaacggggatacgaggatctcgtggaacgactccagcatctcggggcccgcatc
aggaaagagtcgtag

  All links  
No link information was found.   
DBGET integrated database retrieval system