KEGG   Spirochaeta thermophila DSM 6578: Spith_0054Help
Entry
Spith_0054        CDS       T02016                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
stq  Spirochaeta thermophila DSM 6578
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:stq00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Spith_0054
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Spith_0054
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Spith_0054
Enzymes [BR:stq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Spith_0054
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
54720..56027
Genome map
AA seq 435 aa AA seqDB search
MRFVSTRNPKDVVSFEEAVFRGLAPDGGLYHPVERLDLASLYERLGPEKGFVDVSYEMVR
LLFGDEFSEEEAGRLVERAFPFSPVLRELTGSILLLELFHGPSCAFKDFGASFLASCMEV
FLSRREGRAVILTATSGDTGSAVAQAFHGRRHIDVVILYPSGRVSPLQEKQLTTLGGNVH
ALEVAGSFDDCQRMVKEAFLDRELRERCPLTSANSINLGRLVPQSFYYVWAYAQLKARGD
RPFFCVPSGNFGNLTAGVYAWWWGMPVRGFLAATNVNDVVPEYLSTGVFTPRSSVRTLSN
AMDVGNPSNFERLLALFEGDHRRMAAVIRGERVTDEETLDTIARYWREREVFLDPHTAVG
VKASERLLERERGVAPVVTLATAHPGKFLEVVEDALGIRPPLPPQLEEVLAKEKRAVKIP
NTLEALKAFLLDLWG
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgcgtttcgtgagcacgaggaatcccaaggacgtggtctcgttcgaagaggcggtgttc
cgggggcttgctccggacggagggctctaccatccggtggagcgtctggacctcgcctcc
ctctacgagcgtctcggtcccgagaagggcttcgtcgacgtttcgtacgagatggttcgc
ctcctcttcggcgatgagttctcagaggaggaggcgggccggctcgtggaacgggccttt
cccttctctcctgtgctgagggagctcaccggttcgatcctcctcctcgagctcttccat
gggccttcgtgcgccttcaaggacttcggcgcgagctttctcgcgagctgcatggaggtc
ttcctctcccggagggaggggcgggccgtgatcctcacggccacgtcgggggatacgggg
agtgcggtggcacaggccttccacgggcggcggcacatcgatgtggtgatcctctaccct
tcggggagggtgagtccgcttcaggagaagcagctcaccacactgggggggaacgtccat
gccctcgaggtggccggctcgttcgacgattgccagcggatggtgaaggaggccttcctc
gatcgggagctcagggagcggtgtcctctcacgagcgccaattccatcaacctggggagg
ctcgttccgcagtcgttctactacgtgtgggcctatgctcagctgaaggcgcgaggggat
aggcctttcttctgtgtcccgagcgggaacttcggcaatctcaccgccggggtgtatgcg
tggtggtgggggatgccggtgagagggtttctcgcggccaccaacgtgaacgacgtggtg
ccggagtacctttccaccggggtgttcacgccgcggtcgtcggtgaggacgctctcgaat
gccatggatgtgggcaatccgagcaatttcgagcggctcctcgccctcttcgagggggat
caccgccggatggccgcggtgatacggggtgagcgggtgaccgacgaggagacgctcgat
accatcgcccggtactggcgggagcgtgaggtcttcctcgatcctcacacggcggtgggg
gtgaaggcatcggagcgtctcctggaacgggagaggggggtggcgccggtggtgacgctc
gccacggcgcatccgggcaagttcctcgaggtggtcgaggacgcgctggggatcaggcct
cccctccctccccagctcgaggaggtgctcgcgaaggagaagcgggccgtgaagatcccc
aacaccctggaggcgctcaaggccttcctcctcgatctgtgggggtag

DBGET integrated database retrieval system