KEGG   Spirochaeta thermophila DSM 6578: Spith_0089Help
Entry
Spith_0089        CDS       T02016                                 

Definition
nucleotidyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
stq  Spirochaeta thermophila DSM 6578
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:stq00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Spith_0089
   00052 Galactose metabolism
    Spith_0089
   00500 Starch and sucrose metabolism
    Spith_0089
   00520 Amino sugar and nucleotide sugar metabolism
    Spith_0089
Enzymes [BR:stq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Spith_0089
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(109476..110330)
Genome map
AA seq 284 aa AA seqDB search
MKGVIVAAGYGTRFLPATKTVPKELLPLVDIPSLQFIIDEFTASGVDEILVISSRRKKAL
EDYLDREIELELALERAGKPGLLDRIAPPRAHVFIVRQQEMRGTGHALLCARPFIGDEPF
VVAYPDDLHFGNPPLTAQLIKTYRETGCCVLASIHDPPDLSRYGVLKLASDGLHVEDMVE
KPAPGTEPSREISIGRYLFTPDVFPLLEEGWKTHTGGEYYHLYALRRLMAQGKVVHKRVE
GKRIDTGEPSGYLEAILDYALTRDDLREPLRRWISRHVGFLDKT
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggcgtcatcgtcgcggccggctacggcacccgtttccttcccgccaccaagacc
gtgcccaaggagctcctccctctcgtcgacatcccctccctccagttcatcatagacgag
ttcaccgcatccggggtcgacgagatcctcgtcatctcctcgcgcaggaaaaaggccctc
gaagactacctggacagggaaatcgagctcgagctcgctctggaacgggcagggaagccg
ggcctcctcgaccgcatcgccccaccccgagcccacgtcttcatcgtgcgccagcaggag
atgaggggcacgggtcacgccctgctctgtgccagacccttcatcggtgacgagcccttc
gtggtggcctaccccgacgacctccacttcgggaacccacccctcaccgcccagctcatc
aagacctaccgggagacgggctgctgtgtccttgcgagcatacacgaccctcccgacctc
tcccggtacggcgtgctcaaacttgcatcagacggtcttcacgtggaagacatggtggag
aaacccgcacccggcacggaaccgagtcgcgagatctccatcggaaggtacctcttcacg
cccgacgtgttccccctcctcgaagagggatggaagacgcacaccggaggtgaatactac
cacctctacgccctgcggcgcctcatggcccagggaaaggtcgttcacaaacgcgtggaa
gggaaacgaatcgacaccggggaaccgtccggctacctcgaggcgatcctcgactacgcc
ctcacccgggacgaccttcgggaacccttgagacggtggatctcacggcacgtcggattc
ctcgacaagacctga

DBGET integrated database retrieval system