KEGG   Spirochaeta thermophila DSM 6578: Spith_0110Help
Entry
Spith_0110        CDS       T02016                                 

Definition
(GenBank) response regulator receiver modulated CheB methylesterase
  KO
K03412  two-component system, chemotaxis family, protein-glutamate methylesterase/glutaminase [EC:3.1.1.61 3.5.1.44]
Organism
stq  Spirochaeta thermophila DSM 6578
Pathway
stq02020  Two-component system
stq02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:stq00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Spith_0110
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Spith_0110
Enzymes [BR:stq01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Spith_0110
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.44  protein-glutamine glutaminase
     Spith_0110
Two-component system [BR:stq02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Spith_0110
Bacterial motility proteins [BR:stq02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Spith_0110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheB_methylest Response_reg FliO
Motif
Other DBs
NCBI-ProteinID: AEJ60397
UniProt: G0GC33
Position
137261..138328
Genome map
AA seq 355 aa AA seqDB search
MSEKIRVLVVDDSAIVREVLSRLIGGAPDMELAGTAPDPFIARDKILRTNPDVLTLDIEM
PRMDGLSFLERLMHYRPLPVVVVSSVTTKDSTAVVRALELGAFDVVNKPGDSTSVGEVGE
QILEKIRAAYRYRDQFIGKWCLLKEKGARSGPPSHHLSVVETTEKLVVVGASTGGTVALE
EVLSRLPRGMPPVVVVQHMPPVFTAQFARRLDELCTLRVKEAEDGERLEKGTVYIAPGGY
HLVLERRGEFLYVRLTRDEKVNFQRPSVDVLFESAAEVAGKNTLGVLLTGMGKDGAEGLL
RIKESGGHTIAQDEASSIVWGMPRVAVEMGAAKEVLPLDRIAERMVTLVSSEGGG
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagaagatccgtgtgctggtggtggacgactcggcgatcgtgagggaggtcctc
tcacggctcatcgggggggctcctgacatggagctcgcggggaccgccccggatcccttc
atcgcgagggacaagatcctcaggacgaaccccgatgtcctcaccctggacatcgagatg
cctcgtatggacgggctctcgttcctcgagcggctcatgcactaccgccccctcccggtg
gtcgtggtgagctcggtgaccacgaaggactcgacggcggtggtgagggctctggaactg
ggggccttcgacgtggtgaacaagccgggggatagcacgagcgtgggggaggtgggtgag
cagatcctggagaagatccgtgcggcctacaggtacagggatcagttcatcggcaagtgg
tgcctcctcaaggagaagggggcgagatcaggtcctccttcccaccatctctcggtggtg
gagaccaccgagaagctcgtagtggtgggtgcttccaccggcggcacggtggcgttggag
gaggtgctctcccggctcccgagggggatgccgcctgtggtggtggtgcagcacatgccg
ccggtgttcaccgcccagttcgcgcggcgtctggacgagctctgcacgctgcgggtgaag
gaggccgaggatggggaacgtctcgagaagggaacggtgtacatcgcaccgggtgggtac
cacctcgtcctggagagacggggggaattcctctacgtgcgtctcacccgtgacgagaag
gtgaacttccagcgtccctcggtcgatgtgctcttcgagtctgcggcggaagtggccggg
aagaacacccttggtgtgcttctcaccgggatgggcaaggacggagcggagggactcctg
aggataaaggagtcgggaggacacaccatcgcacaggacgaggcctcttcgatcgtgtgg
gggatgccgagggttgcggtggagatgggggcagcgaaggaggtcctccctctggatcgg
atcgccgaacggatggtgacgctcgtctcctcagagggcgggggatga

DBGET integrated database retrieval system