KEGG   Spirochaeta thermophila DSM 6578: Spith_0167Help
Entry
Spith_0167        CDS       T02016                                 

Definition
(GenBank) Indole-3-glycerol phosphate synthase
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
stq  Spirochaeta thermophila DSM 6578
Pathway
stq00400  Phenylalanine, tyrosine and tryptophan biosynthesis
stq01100  Metabolic pathways
stq01110  Biosynthesis of secondary metabolites
stq01130  Biosynthesis of antibiotics
stq01230  Biosynthesis of amino acids
Module
stq_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:stq00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Spith_0167
Enzymes [BR:stq01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Spith_0167
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     Spith_0167
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PRAI
Motif
Other DBs
NCBI-ProteinID: AEJ60454
UniProt: G0GCN5
Position
212891..214333
Genome map
AA seq 480 aa AA seqDB search
MRSGVSGDILDTIVEARRRRVAEEGPAQGMRLPARRDVPLVPFAQDPCLIAEFKRRSPSR
GAIAEEADPVEQVGAYVSQGVRAVSVLTEEGYFGGSLGDLVRIKERFPRVAVLRKDFLLS
EEDVEVSWRAGADAVLLIARVLPEDVLGRMLRRAEELGLSALVEVHTPEDVEKVRRFEPL
LVGINARDLATFRVDLLHPVRMRRLIDWDARVVFESGLWTRTHGYVAGSGGAWGVLVGEA
VMRERGRVRAIMEGLAAGKRDWVRGRRFWSGLAAGRTLVKVCGLAREEDVELADRSGADI
LGFILAPSPRQVDRSFLERMGPVRARRVGVVVGEQGGGLEEAVRLVEEGLLDGIQCHGEE
DPEVLGSLCVPWYKAVRVKERGDLEGVERYGAVRVLLDARVEGAYGGTGMRVPEGVVEAA
GERGPVWLAGGLGPGSVGEVVRRFRPELVDASSGLEAAPGVKDRGRLERFFREIRDAEGV
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgaggagcggggtctcgggggatatcctggatacgatcgtggaggcgaggcggagacgg
gtggcggaggaggggcctgcacaggggatgcggcttcccgcgcggagggatgtgccgctg
gtgcccttcgcccaggatccgtgtctcatcgcggaattcaagcggagatctccctcacgt
ggtgccatcgctgaggaggcggacccggtggagcaggtaggcgcctacgtgtcgcagggg
gtacgggcggtgtcggtgctcaccgaggaggggtatttcggtgggtccctcggtgatctc
gtccgcatcaaagagcgttttccccgtgtggcggtgctccggaaggatttcctcctctcc
gaggaggatgtggaggtgtcctggcgtgcaggggccgacgcggtgctcctcatcgcccgg
gtgctccccgaggatgtgctgggccgaatgcttcggagggcagaggagttggggctttcg
gctcttgtggaggtacacacgcctgaagatgtggagaaggtgaggcggttcgagcctctc
ctggtggggatcaatgcgagggatctggctaccttccgggtggatctcctccacccggtg
aggatgcgacggctcatcgactgggatgcgcgcgtggtcttcgagtcggggctctggacg
aggacgcatggatatgtggcggggagtggcggggcgtggggggtgctggtgggtgaggcg
gtgatgcgggagcgggggagggtgcgggcgatcatggagggactcgccgccgggaagcgg
gactgggtgagggggaggaggttctggagcgggcttgcggccgggaggacgctcgtgaag
gtgtgtggtcttgcccgggaggaggacgtggagctcgcggataggtcgggggccgatatt
cttggcttcatcctcgccccctctccccggcaggtggatcgctcgttcctcgagcggatg
gggccggtgcgggcgaggagggtgggggtggtggtcggagagcaggggggtgggctggag
gaggcggtgcgtttggtggaggaaggtctcctggacgggatccagtgccacggtgaggag
gatccggaggtgctgggatcgctgtgtgtgccgtggtacaaggcggtgcgggtgaaggag
cggggggatctggagggggtggagcggtacggtgcggtgcgggtgctgctggatgcgagg
gtcgagggggcgtacggggggacggggatgcgggtgccggagggggtggtggaggcggcg
ggggagagggggcctgtgtggctggcgggggggctggggccggggagtgtgggggaggtg
gtgcggcgcttcaggcccgagctggtggatgcatcctcagggctcgaggcggcgccggga
gtaaaggataggggcaggctcgaacgattcttcagggagatccgagatgcagaaggtgta
taa

DBGET integrated database retrieval system