KEGG   Spirochaeta thermophila DSM 6578: Spith_0169Help
Entry
Spith_0169        CDS       T02016                                 

Definition
tryptophan synthase subunit alpha
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
stq  Spirochaeta thermophila DSM 6578
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:stq00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Spith_0169
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Spith_0169
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Spith_0169
Enzymes [BR:stq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Spith_0169
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
215537..216298
Genome map
AA seq 253 aa AA seqDB search
MSARIMAHMVSFFPDEARSREVAQALVEGGAWALEIQFPFSDPTADGPAIQEACTRALEA
GFTVEKGFRFLEWLKGRWPDLPVFLMCYGSIPVRKGVDPFVERCAELGLEGLIVPDLPPD
YDEGLYEAGARHGIPVVPVVIPQIRGERLSRILSLSPAYVYAALRKGITGYHTEIGEENL
SLLDTLEAAGTRTLAGFGIDSPEQVALLAPHVHAVVVGSAFVRVIASCSGSPAAPLKAKI
GELLSSKEANRRE
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcacgcatcatggcccatatggtctcgttcttcccggacgaggcgcgttcccgg
gaggtggcacaggccctcgtggaaggaggtgcgtgggcgctcgagatacagttccctttc
tcggatcccacggccgacggtcctgcgattcaggaggcatgcacgcgggctttggaggcg
ggcttcaccgtggagaaggggttccggttcctcgaatggctgaagggacggtggcccgat
ctgccggtcttcctcatgtgttatgggagtatcccggtgcgaaagggggtggatcccttc
gtggaacggtgtgcagagctcggactcgaggggctcatcgttcccgaccttcctcctgac
tacgacgaaggcctctacgaggccggagcccgccatgggattccggtcgtgccggtggtg
attccgcagattcgaggtgagcgactctcccgtatcctctccctttcccccgcctatgtg
tatgcggccctcaggaaggggatcaccgggtatcacaccgagatcggggaggagaacctt
tccctgctcgacacgctcgaggccgcagggacgagaacgctcgccgggttcggcatcgat
tcacccgagcaggtagccctcctcgcaccacacgtccacgcggtggtggtgggatcggcc
ttcgtccgagtgatcgcctcatgcagcgggagccccgcggctcccctcaaggcgaagata
ggggagcttctctcttcgaaggaggctaaccgccgagagtag

DBGET integrated database retrieval system