KEGG   Spirochaeta thermophila DSM 6578: Spith_0238Help
Entry
Spith_0238        CDS       T02016                                 

Definition
(GenBank) Aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
stq  Spirochaeta thermophila DSM 6578
Pathway
stq00010  Glycolysis / Gluconeogenesis
stq00052  Galactose metabolism
stq01100  Metabolic pathways
stq01110  Biosynthesis of secondary metabolites
stq01120  Microbial metabolism in diverse environments
stq01130  Biosynthesis of antibiotics
Module
stq_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:stq00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Spith_0238
   00052 Galactose metabolism
    Spith_0238
Enzymes [BR:stq01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Spith_0238
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: AEJ60524
UniProt: G0GD98
Position
294398..295429
Genome map
AA seq 343 aa AA seqDB search
MQVDKKTFGTTRDGREVYAYTLDTGKGFSCTVISYGATLLSFRMPDREGRVGEITCGFDS
LSDYEERNPYFGSTIGRFANRIGGARFVLDGVEYRLVANEGANQLHGGPGGFHAVVWESE
AFSREDAATVVFSYRSPDGDQGFPGNLEVTASYTLTEEGHLILEYAAETDRPTPVNLTNH
AYWNLSGPGSGLVLDHLLTLRASFYLEVDDGLIPTGRMIPVEGTPFDFRKEKPIGRDFDE
VKGGYDHCFVVDGEGFRQVAVVRDPSTGRRMEVWSTKPGVQFYTGNHLNDIEIAGGVSVP
SYGAFCLETQYFPDSPNKPVFPPCILRPDETYRHRTELRFSVE
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtggacaagaagaccttcggaaccacgcgcgacggaagggaggtgtatgcctat
accctcgacaccggaaaagggttctcgtgtacggtgatcagttacggcgccaccctgctc
tcgttcaggatgcccgatcgggaggggcgggtgggggagatcacctgcggtttcgactcg
ctctccgactacgaggagaggaacccctatttcgggagcaccatagggcggttcgcgaat
cggatcggaggggcgcgtttcgtcctggatggagtggagtaccggctggtggccaacgag
ggagccaatcagcttcacggcgggccgggcgggttccatgccgtggtctgggagtccgag
gccttttcgcgggaggatgccgcgaccgtggtcttctcgtaccggagcccggatggcgat
caggggttcccggggaacctcgaggtcacggcatcctacaccctcaccgaagagggacac
ctcatcctggagtacgccgcagagacggacagacccacgcccgtgaacctcaccaaccac
gcgtactggaacctctcagggccgggctcgggtctggtgctcgaccatctgctcacgctc
cgcgcttcattctacctcgaggtggacgacggcctcatccccacggggcggatgatcccc
gtggagggtacgcccttcgacttcaggaaggagaagccgataggaagggatttcgatgaa
gtgaaggggggatacgaccactgtttcgtggtggatggtgaggggttccgccaggtggcc
gtggtccgcgacccttcgacgggaaggaggatggaggtgtggagcacgaagccgggggta
cagttctacacgggcaaccatctcaacgacatcgagatcgcaggtggggtgagcgtgccc
tcgtatggggctttctgtctggagacccagtactttcccgatagcccaaacaagcccgtg
ttccccccgtgtatcctgaggccggatgagacctatcgtcacaggactgagctcaggttc
tcggtggagtga

DBGET integrated database retrieval system