KEGG   Spirochaeta thermophila DSM 6578: Spith_0239Help
Entry
Spith_0239        CDS       T02016                                 

Definition
phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
stq  Spirochaeta thermophila DSM 6578
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:stq00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Spith_0239
   01230 Biosynthesis of amino acids
    Spith_0239
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Spith_0239
   00030 Pentose phosphate pathway
    Spith_0239
   00051 Fructose and mannose metabolism
    Spith_0239
   00052 Galactose metabolism
    Spith_0239
  Energy metabolism
   00680 Methane metabolism
    Spith_0239
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Spith_0239
Enzymes [BR:stq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Spith_0239
Protein phosphatases and associated proteins [BR:stq01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Spith_0239
Messenger RNA biogenesis [BR:stq03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Spith_0239
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
295660..296841
Genome map
AA seq 393 aa AA seqDB search
MKGAALVGQSGGPTSVINASLAGIIEGIRERSGGRIYGMRFGIEGFLEGDLLDLSSLPDQ
EVGLLKATPGSALGSTRRKLTDEDLPRVRELLEKYDIRYLFLIGGNDTMETIHRVEAYCR
STGYELFGVGVPKTVDNDLVGTDHTPGYPSAARYVVLSVLQGGRLAADMQRVDKFAIHQT
VGRDTGWLAAASVVAKRRPDEAPHLICVPERPLTLDRFLADVERTIASFGYCYIVVGEGV
VWEDGTPVSASQEKDSFSNIEFGAMGGASAALTLHRILKDRLGLRGEFQIPESLAMCASD
RVSAIDREEAYACGRRAVAYANEGRSGIMVTIERSSSNPYRFTLGSIPLEEVARKTKPMP
DEFLTPEGYFVSEAFEEYIRPLVGDIERFARLF
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaagggagccgcactcgtgggacagtcgggcgggccgacttcggtgatcaatgcgagt
ctcgccggcatcatcgaagggatacgggagagatccggaggcaggatctacggcatgagg
ttcgggatcgagggcttcctcgagggggatctcctcgacctctcttccctgccggatcag
gaggtggggcttctcaaggccacgcccggctccgccctggggtccacgagaaggaagctc
accgacgaggatctgccgcgggtgagggagctcctcgaaaagtacgatatccgttacctc
ttcctcatcggtgggaacgataccatggagaccatccacagggtcgaggcctactgtcgg
agtaccggatacgagctcttcggcgtaggcgtgccgaagaccgtggacaacgacctcgtg
ggcaccgatcacacgccggggtatccctccgcggcgcggtacgtcgttctctccgtgctc
cagggggggcgccttgcggccgacatgcagcgtgtggacaagttcgccatccatcaaacc
gtagggcgggatacggggtggctcgcagccgcgagtgtggtggcgaagcggcgtcctgac
gaggcgccccatctcatctgtgttcccgagcgacccctcaccctggatcggtttctcgca
gacgtggagcgcaccattgcatcgttcgggtactgctacatcgtggtgggtgaaggggtg
gtgtgggaggacggcaccccggtctcggcctcgcaggaaaaggacagcttctccaacata
gagttcggcgcgatgggaggagccagtgcagcgttgaccctccatcgcatcctcaaggat
cggctcggtctcaggggcgagttccagattcccgagtcgctcgcgatgtgtgcgagtgat
cgggtctcggcgatcgaccgggaagaggcctatgcctgtgggcgtagggctgtggcgtat
gcgaacgaaggacgttcggggatcatggtgaccatagagaggagctcttcgaatccgtac
cggttcacgttggggagcattcccctggaggaggtggctcgtaagaccaagcctatgccc
gatgagttcctcactccggagggttatttcgtgagtgaggcctttgaggagtacatccgc
ccgctggtgggcgatatcgaacgctttgcccgactcttttag

DBGET integrated database retrieval system