KEGG   Spirochaeta thermophila DSM 6578: Spith_0239Help
Entry
Spith_0239        CDS       T02016                                 

Definition
(GenBank) phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
stq  Spirochaeta thermophila DSM 6578
Pathway
stq00010  Glycolysis / Gluconeogenesis
stq00030  Pentose phosphate pathway
stq00051  Fructose and mannose metabolism
stq00052  Galactose metabolism
stq00680  Methane metabolism
stq01100  Metabolic pathways
stq01110  Biosynthesis of secondary metabolites
stq01120  Microbial metabolism in diverse environments
stq01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:stq00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Spith_0239
   00030 Pentose phosphate pathway
    Spith_0239
   00051 Fructose and mannose metabolism
    Spith_0239
   00052 Galactose metabolism
    Spith_0239
  Energy metabolism
   00680 Methane metabolism
    Spith_0239
Enzymes [BR:stq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Spith_0239
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     Spith_0239
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: AEJ60525
UniProt: G0GD99
Position
295660..296841
Genome map
AA seq 393 aa AA seqDB search
MKGAALVGQSGGPTSVINASLAGIIEGIRERSGGRIYGMRFGIEGFLEGDLLDLSSLPDQ
EVGLLKATPGSALGSTRRKLTDEDLPRVRELLEKYDIRYLFLIGGNDTMETIHRVEAYCR
STGYELFGVGVPKTVDNDLVGTDHTPGYPSAARYVVLSVLQGGRLAADMQRVDKFAIHQT
VGRDTGWLAAASVVAKRRPDEAPHLICVPERPLTLDRFLADVERTIASFGYCYIVVGEGV
VWEDGTPVSASQEKDSFSNIEFGAMGGASAALTLHRILKDRLGLRGEFQIPESLAMCASD
RVSAIDREEAYACGRRAVAYANEGRSGIMVTIERSSSNPYRFTLGSIPLEEVARKTKPMP
DEFLTPEGYFVSEAFEEYIRPLVGDIERFARLF
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaagggagccgcactcgtgggacagtcgggcgggccgacttcggtgatcaatgcgagt
ctcgccggcatcatcgaagggatacgggagagatccggaggcaggatctacggcatgagg
ttcgggatcgagggcttcctcgagggggatctcctcgacctctcttccctgccggatcag
gaggtggggcttctcaaggccacgcccggctccgccctggggtccacgagaaggaagctc
accgacgaggatctgccgcgggtgagggagctcctcgaaaagtacgatatccgttacctc
ttcctcatcggtgggaacgataccatggagaccatccacagggtcgaggcctactgtcgg
agtaccggatacgagctcttcggcgtaggcgtgccgaagaccgtggacaacgacctcgtg
ggcaccgatcacacgccggggtatccctccgcggcgcggtacgtcgttctctccgtgctc
cagggggggcgccttgcggccgacatgcagcgtgtggacaagttcgccatccatcaaacc
gtagggcgggatacggggtggctcgcagccgcgagtgtggtggcgaagcggcgtcctgac
gaggcgccccatctcatctgtgttcccgagcgacccctcaccctggatcggtttctcgca
gacgtggagcgcaccattgcatcgttcgggtactgctacatcgtggtgggtgaaggggtg
gtgtgggaggacggcaccccggtctcggcctcgcaggaaaaggacagcttctccaacata
gagttcggcgcgatgggaggagccagtgcagcgttgaccctccatcgcatcctcaaggat
cggctcggtctcaggggcgagttccagattcccgagtcgctcgcgatgtgtgcgagtgat
cgggtctcggcgatcgaccgggaagaggcctatgcctgtgggcgtagggctgtggcgtat
gcgaacgaaggacgttcggggatcatggtgaccatagagaggagctcttcgaatccgtac
cggttcacgttggggagcattcccctggaggaggtggctcgtaagaccaagcctatgccc
gatgagttcctcactccggagggttatttcgtgagtgaggcctttgaggagtacatccgc
ccgctggtgggcgatatcgaacgctttgcccgactcttttag

DBGET integrated database retrieval system