KEGG   Spirochaeta thermophila DSM 6578: Spith_0248Help
Entry
Spith_0248        CDS       T02016                                 

Definition
phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
stq  Spirochaeta thermophila DSM 6578
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:stq00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Spith_0248
   01230 Biosynthesis of amino acids
    Spith_0248
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Spith_0248
   00030 Pentose phosphate pathway
    Spith_0248
   00051 Fructose and mannose metabolism
    Spith_0248
   00052 Galactose metabolism
    Spith_0248
  Energy metabolism
   00680 Methane metabolism
    Spith_0248
Enzymes [BR:stq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Spith_0248
Protein phosphatases and associated proteins [BR:stq01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Spith_0248
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
306999..308309
Genome map
AA seq 436 aa AA seqDB search
MLFEITSLGTPKIPSPIGLSTVVGDSIANYVGDEEGILHRIEVRKGEQVAADETVVLEKA
GPRERLYFDPKHVHAGIITCGGLCPGLNDVIRSIVRCLWLRYGVRRISGIQFGYRGLLPE
YQYPVIPLDPEVVDDIHKLGGTILGSSRGGGERTEELVDALEQLNINVLFTIGGDGTQRG
ALRMAKEIERRGLKIAVVGVPKTIDNDIMYIDKSFGFETAVALAAQAVSAAHTEAHSAIN
GIGLVKVMGRESGFIAAHTALAVHEANFVLIPEVPFDLEGENGLLVHLERRLARRNHAVI
IVAEGAGQDLMGPSEERDESGNVKLRDIGAFLKDRIKEYFGRRGIPINLRYIDPSYMIRS
APACASDSVYCSRLGTNAVHAAMAGKTRLVIGLVNNHFVHLPMEVVVSQRKRIDPEGSLW
RDVLEATQQPLRMEND
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgttgttcgagattacctcgctgggcacgccaaagatcccttcccccatcggtctctcg
acggtggtaggtgattcgatcgccaactatgtgggcgatgaggaggggattctccacagg
atagaggtgcggaagggcgagcaggtggcggcggacgagaccgtggtgctcgagaaggcg
gggcctcgcgagaggctctacttcgatcccaagcacgtgcacgcggggatcatcacctgc
ggggggctctgcccgggactgaacgatgtgatcagatcgatcgtccgatgcctgtggctc
aggtacggggtgaggaggatctcagggatccagttcggctatcgagggctgctccccgag
taccagtatccggtgatcccgctcgatcccgaggtggtggacgatatccacaagctgggg
ggtacgatactgggttcttcccggggcggtggggaacgtaccgaggagctggtggatgcc
ctcgagcagctcaacatcaacgtgctcttcaccataggtggcgatgggacgcagcggggg
gccttgaggatggcgaaggagatcgagcgccgggggctcaagatcgcggtggtgggggtg
ccgaagaccatcgacaacgacatcatgtacatcgacaagtcgttcgggttcgagaccgcg
gtggcgctcgcggcccaggcggtctcggcggcgcacaccgaggcgcactcggccatcaat
gggataggtttggtgaaggtgatgggcagggagtcggggttcatcgcggcgcacacggcg
ctcgcggtgcacgaggcgaacttcgtgctcatccccgaggtgccgttcgacctcgagggt
gagaacggcctgctcgtccacctggaacggcggctcgcgaggcgcaaccacgcggtgatc
atcgtcgcagagggggcgggccaggacctgatgggcccctccgaggaacgggacgagtca
gggaacgtgaaactgcgggacatcggggcgttcctgaaggatcgcataaaggagtacttc
ggcaggcgtggtattcccatcaacctgcggtacatcgatccgagctacatgatccgcagc
gcgccggcgtgtgcctcggactcggtgtactgttcccgcctggggacgaacgcggtacat
gccgccatggcgggcaagacgcggctcgtgatcggcctggtgaacaaccacttcgttcac
ctcccgatggaggtggtggtctcccagaggaagaggatcgatcccgaggggagtctctgg
cgggacgtgctcgaggccacgcagcagcccttgcggatggagaacgactag

DBGET integrated database retrieval system