KEGG   Spirochaeta thermophila DSM 6578: Spith_0248Help
Entry
Spith_0248        CDS       T02016                                 

Definition
phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
stq  Spirochaeta thermophila DSM 6578
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:stq01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:stq01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:stq00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:stq00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:stq00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:stq00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:stq00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
306999..308309
Genome map
AA seq 436 aa AA seqDB search
MLFEITSLGTPKIPSPIGLSTVVGDSIANYVGDEEGILHRIEVRKGEQVAADETVVLEKA
GPRERLYFDPKHVHAGIITCGGLCPGLNDVIRSIVRCLWLRYGVRRISGIQFGYRGLLPE
YQYPVIPLDPEVVDDIHKLGGTILGSSRGGGERTEELVDALEQLNINVLFTIGGDGTQRG
ALRMAKEIERRGLKIAVVGVPKTIDNDIMYIDKSFGFETAVALAAQAVSAAHTEAHSAIN
GIGLVKVMGRESGFIAAHTALAVHEANFVLIPEVPFDLEGENGLLVHLERRLARRNHAVI
IVAEGAGQDLMGPSEERDESGNVKLRDIGAFLKDRIKEYFGRRGIPINLRYIDPSYMIRS
APACASDSVYCSRLGTNAVHAAMAGKTRLVIGLVNNHFVHLPMEVVVSQRKRIDPEGSLW
RDVLEATQQPLRMEND
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgttgttcgagattacctcgctgggcacgccaaagatcccttcccccatcggtctctcg
acggtggtaggtgattcgatcgccaactatgtgggcgatgaggaggggattctccacagg
atagaggtgcggaagggcgagcaggtggcggcggacgagaccgtggtgctcgagaaggcg
gggcctcgcgagaggctctacttcgatcccaagcacgtgcacgcggggatcatcacctgc
ggggggctctgcccgggactgaacgatgtgatcagatcgatcgtccgatgcctgtggctc
aggtacggggtgaggaggatctcagggatccagttcggctatcgagggctgctccccgag
taccagtatccggtgatcccgctcgatcccgaggtggtggacgatatccacaagctgggg
ggtacgatactgggttcttcccggggcggtggggaacgtaccgaggagctggtggatgcc
ctcgagcagctcaacatcaacgtgctcttcaccataggtggcgatgggacgcagcggggg
gccttgaggatggcgaaggagatcgagcgccgggggctcaagatcgcggtggtgggggtg
ccgaagaccatcgacaacgacatcatgtacatcgacaagtcgttcgggttcgagaccgcg
gtggcgctcgcggcccaggcggtctcggcggcgcacaccgaggcgcactcggccatcaat
gggataggtttggtgaaggtgatgggcagggagtcggggttcatcgcggcgcacacggcg
ctcgcggtgcacgaggcgaacttcgtgctcatccccgaggtgccgttcgacctcgagggt
gagaacggcctgctcgtccacctggaacggcggctcgcgaggcgcaaccacgcggtgatc
atcgtcgcagagggggcgggccaggacctgatgggcccctccgaggaacgggacgagtca
gggaacgtgaaactgcgggacatcggggcgttcctgaaggatcgcataaaggagtacttc
ggcaggcgtggtattcccatcaacctgcggtacatcgatccgagctacatgatccgcagc
gcgccggcgtgtgcctcggactcggtgtactgttcccgcctggggacgaacgcggtacat
gccgccatggcgggcaagacgcggctcgtgatcggcctggtgaacaaccacttcgttcac
ctcccgatggaggtggtggtctcccagaggaagaggatcgatcccgaggggagtctctgg
cgggacgtgctcgaggccacgcagcagcccttgcggatggagaacgactag

DBGET integrated database retrieval system