KEGG   Spirochaeta thermophila DSM 6578: Spith_0361Help
Entry
Spith_0361        CDS       T02016                                 

Definition
glycoside hydrolase clan GH-D
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
stq  Spirochaeta thermophila DSM 6578
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:stq00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Spith_0361
  Lipid metabolism
   00561 Glycerolipid metabolism
    Spith_0361
   00600 Sphingolipid metabolism
    Spith_0361
Enzymes [BR:stq01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Spith_0361
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
434747..436504
Genome map
AA seq 585 aa AA seqDB search
MVRENLTDGAVGAIKEEIGGKEEQVRLCGVHVQEGCFVHSFEGGSLSFQVERVPLGWVVR
GTVEGRPGRLEVVRLPLRFPLLLHSWESWGACPLVDEGWRFPWGERQYEDWRYTVSPVPE
LMREGVVSDYLVAWEHGMAGFLTSRYAHGFFTVEGEELVGYLEFFDREFEEPVPLEPLVV
LEGARMWELLEGYATMAGRENRARVPAYSPLGWCSWYHYFLDLTWDEVRKNLARAREWPF
EVFQVDDAYEADIGDWLEPREGFPSVEEMARVIKEAGFRPGIWTAPFCASSTSRVFREHP
EWFVKEDGRPRVAFRNWDKDIHALDLSNPEVQDHLTGLFSSLRAVGYEYFKIDFLFAGAV
PGERYLKVSPVEAYRMGLETIREAVGDAFILGCGAPLLPSVGLVDGMRIGPDTTPFWDRS
IPDNGAPAIRYALRNALHRAFMHRRFWLNDPDCLLLRKERISLSEEERRTFALTAGALDG
MLVDSDDLALVDEEGKALLHEALSLTGGRPHVRRCGEACYEVISEGTRSGMVRLLVNLSE
EAKVVEGTTVPPHGTVLEREEQALGLSRRVEERDGRRFTYYHREE
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atggtgagggaaaacttgacagatggggccgtgggtgcgataaaggaggagatcggtggt
aaggaggaacaggtgaggctgtgtggtgtgcatgtacaggaagggtgtttcgtccattcc
ttcgaaggaggctctctctcgttccaggtcgaacgtgtacccctcggctgggtggtacgt
gggaccgtggaggggaggccgggacggctcgaggtggtgcgtctgccgctccggttcccc
cttctgctccactcgtgggagtcatggggggcatgtccacttgtggatgaggggtggcgg
ttcccctggggcgagcgtcagtacgaggattggcggtataccgtctccccggtgcctgag
ctcatgcgcgagggggtggtgagcgactacctggtggcatgggagcacgggatggcggga
ttcctcacctcgcggtatgcgcacgggttcttcaccgtggagggggaggaactggtgggc
tacctcgagttcttcgacagggagttcgaggagccggtccccctcgagccgcttgtggtg
ctggagggggcgagaatgtgggagcttctggaggggtatgcgaccatggcggggagggag
aaccgggcgcgggtacctgcgtactcgcctctggggtggtgcagctggtaccactacttc
ctcgacctcacctgggatgaggtgcgaaagaacctcgcccgtgcgagggaatggccgttc
gaggtcttccaggtggacgatgcctacgaggccgatatcggtgactggctcgagccgagg
gaggggtttccgtcggtggaggagatggcgagggtgatcaaggaggcgggcttcaggccg
gggatatggaccgctccgttctgtgcctcctccacctcccgggtcttcagggagcatccg
gagtggttcgtgaaggaggacggtcgtccgcgtgtggccttcaggaactgggacaaggac
atccatgcactcgatctctcgaatcccgaggtgcaggatcacctcacggggctcttctcc
tcgcttagggctgtagggtacgagtacttcaagatagactttctcttcgcaggggctgtt
ccgggggagcgatacctgaaggtgagcccggtggaggcctaccggatgggactcgagacg
atccgggaggcggtcggtgatgccttcatcctggggtgcggggcgccgctcctcccctcg
gtgggtctggtggacgggatgcggatcgggcccgacaccactcccttctgggatcgtagt
atccccgacaacggtgcgccggcgattcggtacgccctccgcaacgccctccaccgtgcc
ttcatgcaccgacggttctggctcaacgatcccgactgcctcctcctgaggaaggagcgg
atctcgctctctgaggaggagaggcgcacgttcgcgttgacggccggggcgctcgacggg
atgctggtggacagcgatgacctggccctggttgatgaggagggaaaggcgctcctgcac
gaggccctgtccctcacaggggggcggccccatgtgcgcaggtgtggtgaggcctgctat
gaggtcatctccgaggggacgaggagcgggatggtgcggcttctggtgaacctctctgaa
gaggcgaaggtggtggagggcaccacggtgcctcctcatgggacggtgctggagagggag
gagcaggcccttggtctttcgcggcgggtggaggagcgggatggtcggcgatttacgtac
taccacagggaggagtag

DBGET integrated database retrieval system