KEGG   Spirochaeta thermophila DSM 6578: Spith_0361Help
Entry
Spith_0361        CDS       T02016                                 

Definition
glycoside hydrolase clan GH-D
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
stq  Spirochaeta thermophila DSM 6578
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:stq00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:stq00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:stq00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
434747..436504
Genome map
AA seq 585 aa AA seqDB search
MVRENLTDGAVGAIKEEIGGKEEQVRLCGVHVQEGCFVHSFEGGSLSFQVERVPLGWVVR
GTVEGRPGRLEVVRLPLRFPLLLHSWESWGACPLVDEGWRFPWGERQYEDWRYTVSPVPE
LMREGVVSDYLVAWEHGMAGFLTSRYAHGFFTVEGEELVGYLEFFDREFEEPVPLEPLVV
LEGARMWELLEGYATMAGRENRARVPAYSPLGWCSWYHYFLDLTWDEVRKNLARAREWPF
EVFQVDDAYEADIGDWLEPREGFPSVEEMARVIKEAGFRPGIWTAPFCASSTSRVFREHP
EWFVKEDGRPRVAFRNWDKDIHALDLSNPEVQDHLTGLFSSLRAVGYEYFKIDFLFAGAV
PGERYLKVSPVEAYRMGLETIREAVGDAFILGCGAPLLPSVGLVDGMRIGPDTTPFWDRS
IPDNGAPAIRYALRNALHRAFMHRRFWLNDPDCLLLRKERISLSEEERRTFALTAGALDG
MLVDSDDLALVDEEGKALLHEALSLTGGRPHVRRCGEACYEVISEGTRSGMVRLLVNLSE
EAKVVEGTTVPPHGTVLEREEQALGLSRRVEERDGRRFTYYHREE
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atggtgagggaaaacttgacagatggggccgtgggtgcgataaaggaggagatcggtggt
aaggaggaacaggtgaggctgtgtggtgtgcatgtacaggaagggtgtttcgtccattcc
ttcgaaggaggctctctctcgttccaggtcgaacgtgtacccctcggctgggtggtacgt
gggaccgtggaggggaggccgggacggctcgaggtggtgcgtctgccgctccggttcccc
cttctgctccactcgtgggagtcatggggggcatgtccacttgtggatgaggggtggcgg
ttcccctggggcgagcgtcagtacgaggattggcggtataccgtctccccggtgcctgag
ctcatgcgcgagggggtggtgagcgactacctggtggcatgggagcacgggatggcggga
ttcctcacctcgcggtatgcgcacgggttcttcaccgtggagggggaggaactggtgggc
tacctcgagttcttcgacagggagttcgaggagccggtccccctcgagccgcttgtggtg
ctggagggggcgagaatgtgggagcttctggaggggtatgcgaccatggcggggagggag
aaccgggcgcgggtacctgcgtactcgcctctggggtggtgcagctggtaccactacttc
ctcgacctcacctgggatgaggtgcgaaagaacctcgcccgtgcgagggaatggccgttc
gaggtcttccaggtggacgatgcctacgaggccgatatcggtgactggctcgagccgagg
gaggggtttccgtcggtggaggagatggcgagggtgatcaaggaggcgggcttcaggccg
gggatatggaccgctccgttctgtgcctcctccacctcccgggtcttcagggagcatccg
gagtggttcgtgaaggaggacggtcgtccgcgtgtggccttcaggaactgggacaaggac
atccatgcactcgatctctcgaatcccgaggtgcaggatcacctcacggggctcttctcc
tcgcttagggctgtagggtacgagtacttcaagatagactttctcttcgcaggggctgtt
ccgggggagcgatacctgaaggtgagcccggtggaggcctaccggatgggactcgagacg
atccgggaggcggtcggtgatgccttcatcctggggtgcggggcgccgctcctcccctcg
gtgggtctggtggacgggatgcggatcgggcccgacaccactcccttctgggatcgtagt
atccccgacaacggtgcgccggcgattcggtacgccctccgcaacgccctccaccgtgcc
ttcatgcaccgacggttctggctcaacgatcccgactgcctcctcctgaggaaggagcgg
atctcgctctctgaggaggagaggcgcacgttcgcgttgacggccggggcgctcgacggg
atgctggtggacagcgatgacctggccctggttgatgaggagggaaaggcgctcctgcac
gaggccctgtccctcacaggggggcggccccatgtgcgcaggtgtggtgaggcctgctat
gaggtcatctccgaggggacgaggagcgggatggtgcggcttctggtgaacctctctgaa
gaggcgaaggtggtggagggcaccacggtgcctcctcatgggacggtgctggagagggag
gagcaggcccttggtctttcgcggcgggtggaggagcgggatggtcggcgatttacgtac
taccacagggaggagtag

DBGET integrated database retrieval system