KEGG   Spirochaeta thermophila DSM 6578: Spith_0427Help
Entry
Spith_0427        CDS       T02016                                 

Definition
L-fucose isomerase
Orthology
K01818  
L-fucose isomerase [EC:5.3.1.25]
Organism
stq  Spirochaeta thermophila DSM 6578
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:stq00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Spith_0427
Enzymes [BR:stq01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.25  L-fucose isomerase
     Spith_0427
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
517749..519554
Genome map
AA seq 601 aa AA seqDB search
MVVKFEDRFGAALPKVGIRPTIDGRRGGVRESLEGVTMEMARVAARLISENLRHPNGAPV
ECVIADTTIGGVAEAAACAEKFRKENVTVTLTVTPCWCYGAETMDMDPHTIKGVWGFNGS
DRPGAVYLAAVLAAHNQKGLPAFGIYGRDVQDFDDVARIPEDVAEKLLRFVRAGIAVSWM
RNKSYLSIGSVSMGIAGSIVDPHFFESYLGMRVEYVDMSELVRRLELGIYDHKEFEQAYS
WVREKCKEGPDNNPPELQHSREKKDEVWATSVKMAMIVRDLMVGNPVLRESGWEEESLGH
HAILAGFQGQRQWTDYFPNGDFLEAILNSSFDWNGIREPYLVATENDSLNGVAMLFGHLL
TGTAQLFSDVRTYWSPAAIERVTGWVPEGEAANGLIHLINSGPTCLDATGKQRTNGRPVI
KPFWEVTEDEVHACLDATLWRYANLGYFRGGGYSTDFLTEGGMPVTMSRVNLVKGVGPVL
QIAEGYTVDVPQHVHDVLDERTDPTWPTTWFVPRLTGKEAFTDVYSVMAHWGANHGAISY
GHIGADLITLASMLRIPVCMHNVPEELIFRPTYWYACGQDPEGADYRACATLGPLYGSYR
R
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atggtagtgaaattcgaggataggttcggagctgcacttccaaaggtaggaatacgaccc
accatcgatggaaggagagggggggtgcgtgaatctctggaaggcgtcaccatggaaatg
gctcgggttgcggctcgactcatttcggaaaaccttcggcatccaaatggtgctcctgtc
gaatgtgtgattgccgataccacgataggtggtgtggcggaagccgcagcatgtgccgaa
aaattcagaaaggaaaatgtgaccgtcacgcttacggtaacgccatgctggtgctatggg
gcggagaccatggatatggacccccataccatcaagggggtctggggtttcaatggttcg
gaccgacctggggcggtatacctcgccgcggttctggctgctcataatcagaagggctta
cctgcttttgggatctacgggagggatgtgcaggatttcgatgatgttgctcgaatccct
gaagatgtggctgagaaactcctgcgttttgtgcgggcgggtatcgctgtgtcctggatg
aggaacaagtcgtatctctcgattgggtcggtctccatggggatcgcaggctcaattgtt
gatcctcacttcttcgaatcgtatctcggcatgcgggtagagtatgtggacatgtcggag
ctcgtaagacgtctcgagttgggtatctatgatcacaaagagttcgaacaggcctattcg
tgggtgagggaaaagtgtaaagagggccccgacaacaatccgcccgaacttcaacatagc
cgggagaaaaaggacgaagtgtgggccacaagcgtaaagatggctatgatcgttcgagat
ttgatggtggggaatcctgtgcttagggagtcaggatgggaggaggaatctttggggcat
cacgccatcctcgctgggttccaaggacaaaggcagtggacggattactttcccaacggg
gatttccttgaggcgatcctcaacagtagtttcgattggaacgggatccgagaaccatat
cttgtggccaccgagaacgattccttgaatggggtggcgatgctcttcggacaccttctt
acaggtaccgctcagctgttctccgatgtgaggacatattggagccccgccgccatcgag
cgagtcaccggatgggtgccggaaggtgaggctgcgaatggtttgattcatctcatcaac
tcaggcccgacgtgtctggatgccacgggaaaacagcgcacgaatggacgtcctgtgatc
aaacctttctgggaagtcacggaggatgaggttcatgcctgcctggatgcgaccctttgg
cggtacgcgaatctgggatatttccgcggtggggggtattctaccgatttcctcacggag
ggggggatgccggtcacgatgtcgagggtcaatctggtaaaaggggtggggcctgtcctg
cagattgcagaagggtatactgtcgatgttcctcagcatgtacacgatgtcctggatgag
agaactgatcccacctggcctaccacctggttcgttcccaggctcacaggaaaggaggca
tttacggatgtatattcggtcatggcccactggggggctaatcatggggccatatcgtat
ggccacatcggcgctgatcttatcaccctcgcctcgatgttgaggatcccggtgtgtatg
cataatgtgcccgaggagctcatcttcagaccgacctattggtatgcatgtgggcaggat
cccgagggagcggattacagggcatgtgccacgctgggcccgttgtatgggagctatcgt
cgctag

DBGET integrated database retrieval system