KEGG   Spirochaeta thermophila DSM 6578: Spith_0768Help
Entry
Spith_0768        CDS       T02016                                 

Definition
glycoside hydrolase family protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
stq  Spirochaeta thermophila DSM 6578
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:stq00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Spith_0768
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Spith_0768
Enzymes [BR:stq01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Spith_0768
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
885538..887220
Genome map
AA seq 560 aa AA seqDB search
MMEWMSRAPFSLSPQDRRWVEETFRSLSLEEKVGQVFVLLCDELSEEKMQYVLGLKPGGI
HRFPNGVSWETLASSAVFLQEHSRVPLLLTGDLEFSFFAVRIGDEGSEFQTQMGVAASSD
PLRDVERMARIAAREGRALGYNVTFSPVVDINYNFRSTITGARTFGSDADMVRRLSEVYV
RVLQEEGMGACAKHWPGDGVDDRDQHLVTSCNSLSRDVWDASYGEVYRGVIQAGVQSIMS
AHICAPALVDGPDRFVPASLSGDLTITFLRERLGFNGVVISDATPMAGFASQGKREDLLP
RALDAGCDIILFSEDPEEDVQIVLDAVKSRRVAPERLDEAVLRILAWKAALGLHRVEDWS
SHVRGLMEEARASREEHARWAEECFASSITLVKHENDILPISPQRYRRVLLLESRPPEVF
GPSGFTPFKDYLEQEGFWVTRMEADVLPDPDLYDLAIYLLDHYTFMSEGRASIPWAELHG
GAFRSMWRFWDDIPTVMISLSSPYFLFEAPTVGTYVNVYSPAEVGLKVLVDLLMGRREFR
GRNPVDPFCGMEDVRVSCGG
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgatggagtggatgagccgagcaccgttttctctttctcctcaggaccggcggtgggtg
gaggagacgttccgatccctctctctcgaagagaaggtcggtcaggtcttcgtcctactg
tgcgatgagctctccgaggagaagatgcagtacgtcctgggactcaagcccggggggatc
catagattcccgaacggagtctcgtgggagacgctcgcttcctcggccgtgttcctccag
gaacactcacgcgtccccctcctcctcaccggcgacctcgagttttccttctttgcggtc
aggatcggtgatgaggggagcgaattccagacacagatgggggtggccgcatcgtccgat
cccctcagggatgtggagaggatggcccgtatcgctgccagggaggggcgggccctgggc
tacaatgtgaccttctcccccgtggtggacataaactacaacttcaggagtaccatcacc
ggagcgaggaccttcgggagcgatgccgacatggtgaggcgtctctccgaggtctacgtc
agggtgctccaggaagaggggatgggagcctgtgcgaagcactggccgggagacggggtg
gacgatcgcgatcagcacctggtgacgtcgtgcaacagcctttcccgcgatgtgtgggat
gcgagctacggtgaggtctaccgaggggtgatacaggccggagtgcagagcatcatgagc
gcccacatctgcgcccctgcgctcgtggacggtcccgatcgtttcgtgccggcctctctc
tcgggggatctcacgatcacattccttcgggagcgtctgggtttcaatggcgtggtgatt
tcggatgccacccccatggcgggtttcgcctcacaggggaagagggaggatctcctgccc
cgtgccctcgatgcgggatgcgatatcatactcttttccgaggaccctgaggaagatgtc
cagatcgtcctcgatgcagtgaagtcgcggcgggtggctcccgagcggttggacgaggcg
gtgttgcgtatcctcgcctggaaagcggccctcggccttcaccgcgttgaggactggtcc
tcgcacgtgagagggctcatggaagaggcgagggcgtcgagggaggaacacgcccggtgg
gccgaagagtgtttcgcctcgtccatcacgctggtgaagcacgagaacgatatcctgccc
atctcgccgcagcggtaccgccgggtgctcctgctggagagccggcctcccgaggtcttc
gggccttcggggttcacccccttcaaggactatctcgagcaggaggggttctgggtgacc
aggatggaggcggatgtgctccccgatcctgatctctacgatctggccatctacctgctc
gatcactacaccttcatgagtgaagggcgggcttcgatcccctgggcggagttgcatggg
ggagcattccgatcgatgtggcgcttctgggacgacatccccacggtgatgatttccctg
agcagtccgtatttcctcttcgaggcgcccacggtggggacgtatgtgaacgtgtattcc
ccggctgaggtgggcctcaaggtgctggtcgatctcctcatggggaggagggagttccgg
gggaggaatcccgtggatccgttctgtggaatggaggacgtgagggtctcctgtggcggg
taa

DBGET integrated database retrieval system