KEGG   Spirochaeta thermophila DSM 6578: Spith_0779Help
Entry
Spith_0779        CDS       T02016                                 

Definition
glycoside hydrolase family protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
stq  Spirochaeta thermophila DSM 6578
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:stq00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
899763..900758
Genome map
AA seq 331 aa AA seqDB search
MKRKWIIVLAAVVVLAAGVGVGLSLATGGSVVDRHGMLQVRGNAICDAHGRRIQLRGMSL
FWSQWSAPFWNPELVRNLARTWKVSLIRAAMGVENAYLTSNKYHKNLLIKVVDAAIEEGI
YVIIDWHSHNIYLPQAEAFFAEMAERYGNVPNVIFEIYNEPDTETWDEIKAYAVRIIETI
RSRGAKNLIVVGTPHWSQDVDVAADDPITGYENIAYTLHFYAGTHREELREKARYALSKG
LPIFVTEWGTCEASGDGPIDVEESERWLAFLDEHMISWANWAMNDKRESASVLVFGASTT
GPWPDDQLTESGRFVKAKIMEAPVRVGERVE
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgaagcggaagtggatcatcgtgctcgcggcggtggtggtgctcgcggcgggcgtgggg
gtgggtctcagcctcgccaccggcggatcggtggtggatcggcacggcatgctccaggtg
aggggcaatgcgatctgcgatgcccatggccgaaggatacagctacggggaatgagcctc
ttctggagtcagtggtcggcgccgttctggaacccggagctggtgagaaacctcgcccgt
acctggaaggtctccctcattcgagctgccatgggggtggagaacgcctacctcacgagc
aacaagtaccacaagaacctcctcatcaaggtggtggatgcggcgatcgaggagggaatc
tatgtgatcatcgactggcactcccacaacatctaccttccgcaggccgaggccttcttt
gccgagatggccgagcggtatggcaacgtaccgaacgtgatcttcgagatctacaatgag
cctgataccgagacatgggacgagatcaaggcctatgcggtgcgcatcatcgagaccata
cgctcgaggggggcgaagaacctcatcgttgtgggcacgccgcactggtcgcaggacgtt
gatgtggcggccgacgatccgattaccgggtacgagaacatcgcctataccctccacttc
tacgcagggacgcaccgggaggagttgagggaaaaggcccggtatgctctttcgaagggg
cttccgatttttgtaacggagtggggtacgtgtgaggcctcgggagatgggccgattgat
gtggaggaatccgaacgttggctcgcctttctggatgaacatatgataagctgggcgaac
tgggccatgaacgacaagcgcgagagtgcctcggtccttgtcttcggggcgagcaccacg
gggccctggcccgacgaccagctcaccgagtcgggacgtttcgtgaaggccaagatcatg
gaggccccggtgagggtgggggagcgggtggagtag

DBGET integrated database retrieval system