KEGG   Spirochaeta thermophila DSM 6578: Spith_0846Help
Entry
Spith_0846        CDS       T02016                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
stq  Spirochaeta thermophila DSM 6578
Pathway
stq00900  Terpenoid backbone biosynthesis
stq01100  Metabolic pathways
stq01110  Biosynthesis of secondary metabolites
stq01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:stq00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Spith_0846
Enzymes [BR:stq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Spith_0846
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_redisom_C DXPR_C DXP_reductoisom NAD_binding_3 DapB_N
Motif
Other DBs
NCBI-ProteinID: AEJ61121
UniProt: G0GBP3
Position
complement(975906..977042)
Genome map
AA seq 378 aa AA seqDB search
MKKRIIVLGCTGSIGRNALEVVRAYPERLEVVGLSAHTRDRELLAAAREFGVERLALTGK
RGGGVPYEGEEGLLHLIEETEADIVVNGIAGTRGLLPSLKALETGKDLALANKESLVVAG
ELLLETATRNGRHILPVDSEHAAIFSLLRNVPPDAVKALYLTASGGALRDIPLSRLEEIT
PEEALRHPTWEMGPKITIDSATLANKGLEVIEAAVLFGVPPESVRVVIHPQSVVHGLILL
RDGSWHAQMSTPDMRLPIQQALFHPEVPPQAPAPLLLEEGLDLSFRPVDGRRYPMLGLAY
QALASQGKRIAFNAANEEAVRAFLERRISFPRIAEVVESVLAREWPSPRGGISPILALDA
EVRRVTEGILKERSDHAS
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaacggatcatcgtcctcggatgcacgggaagcatcggaaggaacgccctggaa
gtggtgcgggcctatcccgagcgcctcgaggtggtgggtctctcggcgcataccagggat
cgggagctcctcgcggccgcccgggagttcggcgtggaacgcctggcgctcacaggaaaa
cgaggcggaggggtcccttacgagggcgaggaaggtctcctccacctcatagaggagacc
gaagccgacatcgtggtgaacggtatcgcggggacgagaggcttgctcccctccctcaag
gccctcgagaccggcaaggatctcgccctcgccaacaaagagagcctcgtggtggcggga
gaactcctcctcgagacagccaccaggaacgggcggcacatccttcccgtggattccgaa
cacgcagccatcttctctctgctccggaatgttcctccggatgcagtgaaggccctctat
ctcactgcctccgggggagcactgcgggacatccccctctcacgactcgaggagatcacc
cccgaagaggcgctcagacatcccacctgggagatgggccccaagatcaccatcgactcg
gccaccctcgcgaacaaaggactcgaggtgatcgaggccgcggtcctcttcggtgtgcct
cccgaatccgtacgggtggtcatccacccccagagcgtggtacacggtctcatcctgctc
cgtgacgggtcgtggcacgctcagatgagcaccccggacatgcggctccccatccagcag
gccctgttccatcccgaggtcccaccccaggcccccgctccgcttctcctggaggaggga
ctcgacctcagcttcaggccggtggacgggcggcggtaccccatgctcgggctcgcctac
caggctctcgcttcacaggggaagcgcatcgccttcaatgcggcgaacgaagaggccgtc
cgggccttcctcgagcgcaggatctccttcccccggatcgccgaggtggtggaatccgta
ctcgccagggaatggccttcccctcggggagggatctcccctatactggcactggatgcc
gaagtgcgcagggttacggaaggtatcctgaaagagaggagtgatcatgcttcttaa

DBGET integrated database retrieval system