KEGG   Spirochaeta thermophila DSM 6578: Spith_0877Help
Entry
Spith_0877        CDS       T02016                                 

Definition
alpha amylase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
stq  Spirochaeta thermophila DSM 6578
Pathway
Starch and sucrose metabolism
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:stq00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1005783..1007546
Genome map
AA seq 587 aa AA seqDB search
MEPVDRMRELLSFIYGPETGRDTHEALHALLDGWRGRLPSPDEEYASGRLPLDHTDAVLI
TYGDQFGRKGEAPLATLGEFLREYLSGTMKGVHILPFFPYSSDDGFSVMDYRRVNPEWGT
WDDVRRISEDFRLMVDLVLNHCSAKSEWFRRFLQGDPEYEDFFITVEPGTDLSGVFRPRA
LPLVHEFESAKGPVLVWTTFSRDQVDLNYANPRVLLEMIDIFLFYVSQGAQIIRLDAIAY
LWKELGTPCIHHPKTHAVVKLFRAICEEVCPWVLIITETNVPHKENISYFGDMDEAHLVY
QFALPPLVLDAFLRKDVSYLREWARTIDTYGGKVSYFNFLASHDGIGVLPARGILPDEYI
DAMIEAVKDRGGLISYKSTPQGEVPYELNINYLSAISESHLDRPTRARKFLASQAVMLSL
VGMPGIYVHSLLGSENWREGVEKTGMNRTINRQKLSYEGVLEELRDPESLRSMVFEGYLD
MLAARRKSRAFDPRGMQEVLEAPETVFALLRRSPDATEEVLCLINVSHIEQECVFPSSIF
RTAPDAHLFTELTSGDTLVPYREDEDRFSISLGGYEVLWLTPYRDKG
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atggaacctgtggatcgcatgagagagctcctctcgttcatctatggaccggagacggga
cgtgacacccatgaggcgcttcatgcccttcttgatgggtggaggggccgtcttccttct
cctgacgaggagtatgcctccggccgccttccgctcgatcacacagatgcggtgctcatc
acgtatggtgatcagttcggaagaaaaggggaagcccccctcgccaccctcggagagttc
cttcgagagtacctctccggcacgatgaagggagtccatatcctcccctttttcccctat
tcctccgacgacggattctcggtgatggactaccgccgggtgaacccggaatggggcacc
tgggacgatgtccgccgtataagcgaagacttccgcctcatggtggacctcgtactcaac
cattgttctgccaagagcgagtggttcaggcgcttcctccagggcgatcctgagtacgag
gacttcttcatcaccgtggagcccggcaccgatctctcaggggtcttcagaccccgtgcc
cttccccttgttcacgagttcgagagtgcgaaggggccggtactggtgtggaccaccttc
agccgggatcaggtggatctcaactatgcgaacccacgggtcctcctggagatgatcgac
atcttcctcttttatgtctctcaaggggcccagatcatcaggcttgatgccatcgcctat
ctgtggaaggaactcggtactccctgtatccatcaccccaagacccatgccgtggtgaag
ctcttcagggcgatctgtgaggaggtctgcccctgggtcctcatcatcaccgagaccaat
gtgcctcacaaagaaaacatctcctatttcggtgatatggacgaggcccatctcgtgtat
cagttcgcccttcctcccctcgtcctggatgcctttctccggaaagatgtctcctacctc
agggagtgggcacgtaccatcgatacctacggcggaaaggtgagctacttcaatttcctt
gcctctcatgatgggataggcgtacttccggctcgaggcattctccctgatgagtacatc
gatgccatgatcgaggcggtgaaggatagaggagggctcatttcctacaagagtacaccc
cagggagaggtgccctatgagctcaacatcaactatctgagtgcgatcagcgagagccac
ctcgaccgcccgacccgggcgaggaagttcctcgcaagccaagccgtgatgctctccctg
gtggggatgcccggaatctatgtccacagccttctgggttcggaaaactggcgcgaaggg
gtggagaagaccgggatgaaccgcacgatcaaccggcagaagctctcctacgaaggggtg
ctcgaggagctacgcgatcctgagagcctgaggagcatggtcttcgagggctacctcgac
atgctcgccgcccgacggaagagtcgcgcctttgatcccagggggatgcaggaggtgctc
gaggcccctgagaccgtgtttgccctcctgaggaggagccctgacgccacagaggaggtg
ctctgcctcatcaacgtgagccacatcgagcaggagtgcgtcttcccctcctcgatattc
agaaccgcgccggatgcgcacctgttcaccgagctcacaagcggggacaccctcgtcccc
taccgagaggacgaggaccgcttctccatctcgctcggcggctacgaggtcctctggctc
acaccgtatcgggacaagggctga

DBGET integrated database retrieval system