KEGG   Spirochaeta thermophila DSM 6578: Spith_0936Help
Entry
Spith_0936        CDS       T02016                                 

Definition
flagellar motor switch protein FliG
Orthology
K02410  
flagellar motor switch protein FliG
Organism
stq  Spirochaeta thermophila DSM 6578
Pathway
Bacterial chemotaxis
Flagellar assembly
Class
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:stq02030]
Cellular Processes; Cell motility; Flagellar assembly [PATH:stq02040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1064011..1065072
Genome map
AA seq 353 aa AA seqDB search
MGKTKTAAPASGHQVKKPGVKRELTGRQKAAILLVTLGSELSAEIFKHLKEDEIESLTFE
IARLETIDSEERDKVLMEFQELMMAQEFIITGGVDYARELLEKALGTQKAVDIINRLTSS
LQVRPFDFVRRTDPTQLLNFIQQEHPQTIALILSYLDPQKASVILASLDHDIQAEVAKRI
ATMDRTSPEVLREVERVLEKKLSTLASEDYTMAGGVDAIVEILNMVDRSTEKSIIESLEE
EDPELAEEIKKKMFVFEDIVLLDDRAIQKVLREVDTQELAKALKAVDAEVQDKIFRNMSK
RAATLLKEDMEYMGPIRMRDVEEAQQKIVSIIRKLEEQGEIVIARGGEDEIVV
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgggcaagaccaagaccgcagcgcccgcttccgggcatcaggtgaagaagccgggggtg
aagagagagctcaccggccggcagaaagcggccatcctcctggtgacgctgggttcggag
ctctcggcggagatcttcaaacacctcaaggaggacgagatagagagcctcaccttcgag
atcgcccgtctcgagacgatcgattcggaggagcgggacaaggtcctcatggagttccag
gaactcatgatggcccaggagttcatcatcaccggcggggtcgactacgcccgcgaactc
ctcgagaaggccctcggtacccagaaggcggtggacatcatcaaccggctcacgagcagt
ctccaggtgcggcccttcgacttcgtgcggcgtaccgatcccacacagctcctcaacttc
atccagcaggagcacccgcagaccatcgccctcatcctctcctacctggatccccagaaa
gcctcggtgatcctcgcgagcctcgaccacgacatccaggccgaggtggcgaaacggatc
gccaccatggaccgcacctcacccgaggtcttgcgcgaggtggagcgggtgctcgagaag
aagctttccaccttggcctccgaggattacaccatggccggaggggtggacgccatcgtg
gagatcctcaacatggtggatcgttccaccgagaagtccatcatcgagtcgctcgaggag
gaggatcctgagctcgccgaggagatcaagaagaagatgttcgtcttcgaggacatcgtg
ctcctggacgacagggcgatccagaaggtgctccgcgaggtggacacgcaggagctcgcc
aaggccctcaaggccgtggatgccgaggtgcaggacaagatcttccgcaacatgtccaag
cgtgcggcgaccctcctcaaggaggacatggagtacatggggccgatccgtatgagggac
gtcgaggaggcccagcagaagatcgtctccatcatcaggaaactcgaggagcagggcgag
atcgtcatcgcgcgcggcggtgaggatgagatcgtggtatag

DBGET integrated database retrieval system