KEGG   Spirochaeta thermophila DSM 6578: Spith_0936Help
Entry
Spith_0936        CDS       T02016                                 

Definition
flagellar motor switch protein FliG
Orthology
K02410  
flagellar motor switch protein FliG
Organism
stq  Spirochaeta thermophila DSM 6578
Pathway
Bacterial chemotaxis
Flagellar assembly
Brite
KEGG Orthology (KO) [BR:stq00001]
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Spith_0936
   02040 Flagellar assembly
    Spith_0936
Bacterial motility proteins [BR:stq02035]
 Flagellar system
  Flagellar assembly proteins
   C-ring
    Spith_0936
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1064011..1065072
Genome map
AA seq 353 aa AA seqDB search
MGKTKTAAPASGHQVKKPGVKRELTGRQKAAILLVTLGSELSAEIFKHLKEDEIESLTFE
IARLETIDSEERDKVLMEFQELMMAQEFIITGGVDYARELLEKALGTQKAVDIINRLTSS
LQVRPFDFVRRTDPTQLLNFIQQEHPQTIALILSYLDPQKASVILASLDHDIQAEVAKRI
ATMDRTSPEVLREVERVLEKKLSTLASEDYTMAGGVDAIVEILNMVDRSTEKSIIESLEE
EDPELAEEIKKKMFVFEDIVLLDDRAIQKVLREVDTQELAKALKAVDAEVQDKIFRNMSK
RAATLLKEDMEYMGPIRMRDVEEAQQKIVSIIRKLEEQGEIVIARGGEDEIVV
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgggcaagaccaagaccgcagcgcccgcttccgggcatcaggtgaagaagccgggggtg
aagagagagctcaccggccggcagaaagcggccatcctcctggtgacgctgggttcggag
ctctcggcggagatcttcaaacacctcaaggaggacgagatagagagcctcaccttcgag
atcgcccgtctcgagacgatcgattcggaggagcgggacaaggtcctcatggagttccag
gaactcatgatggcccaggagttcatcatcaccggcggggtcgactacgcccgcgaactc
ctcgagaaggccctcggtacccagaaggcggtggacatcatcaaccggctcacgagcagt
ctccaggtgcggcccttcgacttcgtgcggcgtaccgatcccacacagctcctcaacttc
atccagcaggagcacccgcagaccatcgccctcatcctctcctacctggatccccagaaa
gcctcggtgatcctcgcgagcctcgaccacgacatccaggccgaggtggcgaaacggatc
gccaccatggaccgcacctcacccgaggtcttgcgcgaggtggagcgggtgctcgagaag
aagctttccaccttggcctccgaggattacaccatggccggaggggtggacgccatcgtg
gagatcctcaacatggtggatcgttccaccgagaagtccatcatcgagtcgctcgaggag
gaggatcctgagctcgccgaggagatcaagaagaagatgttcgtcttcgaggacatcgtg
ctcctggacgacagggcgatccagaaggtgctccgcgaggtggacacgcaggagctcgcc
aaggccctcaaggccgtggatgccgaggtgcaggacaagatcttccgcaacatgtccaag
cgtgcggcgaccctcctcaaggaggacatggagtacatggggccgatccgtatgagggac
gtcgaggaggcccagcagaagatcgtctccatcatcaggaaactcgaggagcagggcgag
atcgtcatcgcgcgcggcggtgaggatgagatcgtggtatag

  All links  
No link information was found.   
DBGET integrated database retrieval system