KEGG   Spirochaeta thermophila DSM 6578: Spith_1006Help
Entry
Spith_1006        CDS       T02016                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
stq  Spirochaeta thermophila DSM 6578
Pathway
stq00010  Glycolysis / Gluconeogenesis
stq00051  Fructose and mannose metabolism
stq00562  Inositol phosphate metabolism
stq01100  Metabolic pathways
stq01110  Biosynthesis of secondary metabolites
stq01120  Microbial metabolism in diverse environments
stq01130  Biosynthesis of antibiotics
stq01200  Carbon metabolism
stq01230  Biosynthesis of amino acids
Module
stq_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
stq_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:stq00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Spith_1006
   00051 Fructose and mannose metabolism
    Spith_1006
   00562 Inositol phosphate metabolism
    Spith_1006
Enzymes [BR:stq01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Spith_1006
Exosome [BR:stq04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Spith_1006
  Exosomal proteins of bladder cancer cells
   Spith_1006
  Exosomal proteins of melanoma cells
   Spith_1006
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM Oxidored_nitro
Motif
Other DBs
NCBI-ProteinID: AEJ61278
UniProt: G0GCY6
Position
1137601..1138362
Genome map
AA seq 253 aa AA seqDB search
MTERRPFIAGNWKMHKTTGEARALAEALVENLKDCPHKVMVAPPFTALSAVREVLKGSPI
LLGAQNMCSVREGAHTGEISVLMLKDLDVSVVILGHSERRLIYGETDRLINEKVRLALEE
GMEVILCVGETLEQREAGKAEQVVEEQVKRGLDGVAPEDLSRVTIAYEPVWAIGTGRTAR
PEDADAMHRHIRRTVASLHGTDAAEALIIQYGGSVKPSNIKALMAMENIDGALVGGASLS
AENFLPIVNFHLE
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
gtgactgagagacggcctttcatcgcaggaaactggaagatgcacaagacgacaggggag
gctcgtgcccttgcggaggcccttgtggagaacctcaaggactgcccccacaaggtgatg
gtcgctcctcccttcactgccctctccgcggtgcgggaggtgctgaagggatcccctatc
ctcttgggggcacagaacatgtgttccgtgagggagggcgcccacaccggtgagatctcc
gtcctcatgctcaaggatctcgatgtctcggtggtgatactgggccattccgaacgacgt
ctcatctatggagagaccgacaggctcatcaacgaaaaggtacgcctcgcgctcgaagag
gggatggaggtcatcctctgcgtgggggagaccctcgaacagagggaggccggcaaggca
gaacaggtggtcgaggagcaggtgaagcgagggctcgatggagtggccccggaggatctc
tcccgtgtgaccatcgcgtatgaaccggtatgggccatcgggacggggcggaccgcgcga
cctgaagatgccgacgcgatgcacaggcacatccgcaggaccgttgcaagtctacacggt
acggatgcggcggaggccctcatcatccaatatgggggctccgtgaagccgagcaatatc
aaggcgctcatggcgatggagaatatcgacggggcgctggtgggcggcgcctccctctcc
gcggagaacttcctgcccatcgtaaactttcatctggagtga

DBGET integrated database retrieval system