KEGG   Spirochaeta thermophila DSM 6578: Spith_1006Help
Entry
Spith_1006        CDS       T02016                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
stq  Spirochaeta thermophila DSM 6578
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:stq00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Spith_1006
   01230 Biosynthesis of amino acids
    Spith_1006
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Spith_1006
   00051 Fructose and mannose metabolism
    Spith_1006
   00562 Inositol phosphate metabolism
    Spith_1006
Enzymes [BR:stq01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Spith_1006
Exosome [BR:stq04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Spith_1006
  Exosomal proteins of bladder cancer cells
   Spith_1006
  Exosomal proteins of melanoma cells
   Spith_1006
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1137601..1138362
Genome map
AA seq 253 aa AA seqDB search
MTERRPFIAGNWKMHKTTGEARALAEALVENLKDCPHKVMVAPPFTALSAVREVLKGSPI
LLGAQNMCSVREGAHTGEISVLMLKDLDVSVVILGHSERRLIYGETDRLINEKVRLALEE
GMEVILCVGETLEQREAGKAEQVVEEQVKRGLDGVAPEDLSRVTIAYEPVWAIGTGRTAR
PEDADAMHRHIRRTVASLHGTDAAEALIIQYGGSVKPSNIKALMAMENIDGALVGGASLS
AENFLPIVNFHLE
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
gtgactgagagacggcctttcatcgcaggaaactggaagatgcacaagacgacaggggag
gctcgtgcccttgcggaggcccttgtggagaacctcaaggactgcccccacaaggtgatg
gtcgctcctcccttcactgccctctccgcggtgcgggaggtgctgaagggatcccctatc
ctcttgggggcacagaacatgtgttccgtgagggagggcgcccacaccggtgagatctcc
gtcctcatgctcaaggatctcgatgtctcggtggtgatactgggccattccgaacgacgt
ctcatctatggagagaccgacaggctcatcaacgaaaaggtacgcctcgcgctcgaagag
gggatggaggtcatcctctgcgtgggggagaccctcgaacagagggaggccggcaaggca
gaacaggtggtcgaggagcaggtgaagcgagggctcgatggagtggccccggaggatctc
tcccgtgtgaccatcgcgtatgaaccggtatgggccatcgggacggggcggaccgcgcga
cctgaagatgccgacgcgatgcacaggcacatccgcaggaccgttgcaagtctacacggt
acggatgcggcggaggccctcatcatccaatatgggggctccgtgaagccgagcaatatc
aaggcgctcatggcgatggagaatatcgacggggcgctggtgggcggcgcctccctctcc
gcggagaacttcctgcccatcgtaaactttcatctggagtga

DBGET integrated database retrieval system