KEGG   Spirochaeta thermophila DSM 6578: Spith_1065Help
Entry
Spith_1065        CDS       T02016                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
stq  Spirochaeta thermophila DSM 6578
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:stq00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1197579..1198487
Genome map
AA seq 302 aa AA seqDB search
MWSTRTRGGKLWDALVLSPAKVNFHLEILDTREDGYHNIRSIFQTISIFDRIWIRSLTDA
EEDVVDGVPATPEESTVHRAVRIFREATGWRGYVHVKVEKRIPSGAGLGGASSNAAAVLR
VLDTLTGVGLGEERLAELGLEVGSDVPFFCRAPAALVEGRGEVIRPVKPRDDFWLLCVAP
GFPISTVQAYALYDERKEVVMHEGLSPRRIVKSYEMYAPEKWGFRNAFFDVLVPRYPLLQ
DIVQGLGELGALYANVSGSGSVVYGVFPSFADLVRADAAMVRQGYETYRAHPLKRLPRVW
CA
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgtggagcactaggacgagaggtggaaagctctgggatgccctggtactctcccctgcc
aaagtgaacttccacctcgaaatacttgacacgagggaggatggttatcataatatacga
tcgatattccagacgatatccatattcgacaggatatggattcgttctttgacagacgcg
gaagaagatgtagtggatggtgttccggccactcctgaagagagtactgttcacagggca
gtccggatcttcagagaggcgacggggtggagaggatatgttcatgtcaaggtggaaaaa
cgcatcccttccggggcaggtctcggcggggcttcgagcaatgctgctgccgtgctgagg
gtgctcgataccctcacgggagtcggtttgggagaagagcgactcgctgaactcggactg
gaggtgggcagcgatgttcccttcttttgtcgtgctccggccgccctcgtggagggaagg
ggggaggtgatccgtccggtgaaacccagagacgacttctggctcctgtgtgtggcacct
ggatttcccatatccaccgtgcaggcgtacgcactttacgatgaacggaaagaggtcgtg
atgcacgaggggttgtccccgaggcggatcgtgaagtcctatgagatgtacgctccagaa
aaatgggggtttcgcaatgcgtttttcgacgtactcgttccccgatatcctctcctccaa
gatatcgtgcagggcttgggtgagttaggggccctctacgcgaacgtctcaggtagtggg
agtgtggtgtacggggttttcccctcctttgccgatctcgtgagggcggatgctgcgatg
gttcgacagggttatgaaacctatcgagctcaccccctgaaacggttgcctcgtgtatgg
tgcgcctga

DBGET integrated database retrieval system