KEGG   Spirochaeta thermophila DSM 6578: Spith_1129Help
Entry
Spith_1129        CDS       T02016                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
stq  Spirochaeta thermophila DSM 6578
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:stq00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1261263..1261763)
Genome map
AA seq 166 aa AA seqDB search
MATTYIAVGSNRGDSLGIVGRLLSALRKRDPELRCASLYRSEPMYLRDQPDFLNTVIEFH
TDLHPEALLRFLQELETNAGRNRAEEPRYGPRPLDLDILLYDDLLLTTPSLQIPHPRMQE
RLFVLVPLLELAPDLVDPRDGIPFRVKQEQAALHHPLHLEKIAPLV
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atggcgacgacgtatatcgctgtgggttcgaacaggggagattccctcggtatagtggga
cgcctcctttctgccctcaggaagagggacccggagctgcggtgtgcttcgctctacaga
tcggaacccatgtacctgagggaccaaccggacttcctcaacacagtgattgagttccat
accgaccttcaccccgaagccctcctgaggtttctccaggagctcgaaaccaacgcgggc
aggaacagggccgaagaaccacgttacggcccgagaccgctcgatctcgacatactcctc
tacgacgatctgctgctcaccaccccttccctccagatcccccatcccaggatgcaggaa
cgactcttcgtgctcgtgcctctcctggaactcgcccctgacctcgtggacccccgggac
ggaatcccgttccgggtgaaacaggagcaggccgctctccaccatcctcttcaccttgaa
aaaatagcgccgctggtatag

DBGET integrated database retrieval system