KEGG   Spirochaeta thermophila DSM 6578: Spith_1266Help
Entry
Spith_1266        CDS       T02016                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
stq  Spirochaeta thermophila DSM 6578
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:stq00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:stq00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:stq02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1414862..1416322
Genome map
AA seq 486 aa AA seqDB search
MKRLIVSLLLLVSLLPMGAGGTRETGSAPKVSPEPSQPKAKYIFFFIGDGMGLPQINAAE
AYLMAREQKDAPLRLSFTTFPATGMATTYSSDSYITDSAAAGTALAAGRKTANGVINMDP
GKTRTFTTIAERLYERGLKVGIISTVSIDHATPASFYAHQPSRSNYYEIGLELAKSGFEF
FGGGGFRDPEGKRSKREGGKPNVLEEARKAGYTILTTEEEILGLSPGSAQKVIAINPVLP
SSAAMPYKIDRDEESLDLADFTRKAVEFLENPEGFFIMVEGGKIDWACHANDAVAAIQDV
LDFDEAVQVAVEFARRHPDETLIVVTGDHETGGLTIGFAGTRYENAFPVLLNQKVSFEGF
NAVFESYKSKKGLTLDDVMPLVREYFGIESLTPYEEEVLSRALRASLEGVPEDDPQSYLL
YGGYEPFTVTLTHVVNNRAGLGWTTWSHTGVPVPVYATGPGAHLFTGYYDNTDIPKRIAR
LAGVDL
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgaagagactcatcgtatccctgttactactcgtctccctgctacccatgggggcaggg
ggaacgagggagaccggatccgctcccaaggtctccccagagccttctcagccgaaggcg
aagtacatcttcttcttcatcggggacggtatgggccttccgcagatcaatgcggccgag
gcctacctcatggcccgggagcagaaggatgccccgctacggctctcgttcaccacgttc
cccgccaccggcatggcgaccacctattcctcggacagctacatcacggactcggcagcc
gcgggcactgcactcgcggcgggtaggaagactgccaacggggtgatcaacatggacccg
gggaaaacccggaccttcaccacgattgcagagcggctctatgaaagaggcctcaaagtg
ggtatcatctccacggtctccatcgaccacgccacccctgcctctttctacgcccatcaa
cccagtagaagcaactactacgagatcggtctggagctcgcaaagagcgggttcgagttc
ttcggtggagggggattccgcgatccggagggaaagagaagtaagagggaaggagggaag
cccaacgtgctcgaagaggcgaggaaggccggctataccatcctcaccaccgaggaggag
atcctgggtctctctcctgggtcggcgcagaaggtgatcgcgatcaatcccgtgctccct
tcatccgctgcgatgccctacaagatcgatagggacgaggagtctctcgatcttgccgac
ttcacacgaaaggccgtggagttcctcgagaatccagagggcttcttcatcatggtggag
gggggtaagatcgactgggcctgtcatgcgaacgatgcagtggcggccatacaggacgtc
ctcgacttcgacgaggcggtgcaggtggccgtggagttcgcacgacggcatccggatgag
accctcatcgtggtcaccggcgaccatgagacagggggactcaccatagggttcgccggc
acgagatacgagaatgccttcccggtgctcctcaaccagaaggtctcgttcgaggggttc
aatgcggtcttcgaatcatacaagagtaaaaagggcctcacgctcgacgatgtgatgccc
ctggtgagggaatacttcgggatcgagtccctcactccctacgaggaagaggtgctctcg
cgcgccctccgggcgagtctggaaggggttcctgaggatgatcctcagtcctacctcctc
tacggcgggtacgaaccgttcaccgtgaccctcacccatgtggtgaacaaccgtgccggc
ctcggctggacgacctggagccacacgggagttcctgtgccggtctatgccacaggaccc
ggggctcacctcttcacaggttactacgacaataccgatatcccgaagcggatcgcccgg
ttggcgggtgtggacctgtag

DBGET integrated database retrieval system