KEGG   Spirochaeta thermophila DSM 6578: Spith_1353Help
Entry
Spith_1353        CDS       T02016                                 

Definition
(GenBank) glycoside hydrolase family 4
  KO
K07406  alpha-galactosidase [EC:3.2.1.22]
Organism
stq  Spirochaeta thermophila DSM 6578
Pathway
stq00052  Galactose metabolism
stq00561  Glycerolipid metabolism
stq00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:stq00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Spith_1353
  Lipid metabolism
   00561 Glycerolipid metabolism
    Spith_1353
   00600 Sphingolipid metabolism
    Spith_1353
Enzymes [BR:stq01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Spith_1353
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_4 Glyco_hydro_4C
Motif
Other DBs
NCBI-ProteinID: AEJ61617
UniProt: G0GFS4
Position
1521804..1523189
Genome map
AA seq 461 aa AA seqDB search
MSHVQQSLEIAYIGGGSRGWAWKLMADLALEPALTGRVRLYDIDQEAARLNERIGNRLSS
RSDVKGKWHYETRTSLKDALEGVDVVIISIMPGTFKEMEVDVHAPEPFGIYQSVGDTTGP
GGLFRALRTIPIYEEFAQAIKTWAPKAWVINYTNPMALCVRTLYEVFPEVKAFGCCHEVF
GTQELLASMVVHEGLVQDPPQRREIHINVLGLNHCTWIDRASFRGVDLLPMYRRFAERHR
EEGFETGGERTWENDYFTSAHKVKFDLFLRFGLIAAAGDRHLAEFFPVSWYLKDPETVRS
WKFSLTPVSWRVENQKSLEARARRLASGEEEVELAPSGEEGVLMLKAIAGVEETVSNVNL
PNRGQIANLPPGTVVETNALFRYDSVQPVQAGALPSSLLGHLTRHVAQQETISRAGLERN
WDLAFRAFLSDPLVAHLSPSEAERLFSLMREKLSPSMPGWE
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgagtcacgtacaacagtcactcgagatcgcctacataggagggggatcccgcggatgg
gcatggaagctcatggcggatctcgcactcgaacccgccctcaccggaagggtccgcctc
tacgacatcgatcaggaggcggcgcgcctcaacgaacggatcggcaaccggctctccagc
cgctccgatgtgaaggggaagtggcactacgagaccaggacgagcctcaaggatgcgctc
gagggcgtggatgtggtgatcatctccatcatgcccggcaccttcaaggagatggaggtg
gacgtccatgcgcccgagcccttcgggatctaccagtcggtgggcgacaccacgggaccg
ggcggcctgttcagggccctgaggaccattccgatctacgaagagttcgcgcaggccatc
aagacctgggcgcccaaggcctgggtgatcaactacaccaaccccatggcactctgtgtg
cggaccctctacgaggtgttcccggaggtgaaggccttcggatgctgtcatgaggtcttt
ggaacccaggaactcctcgcctcgatggtggtacacgagggccttgtccaggatcctccg
cagcgcagggagatccacatcaatgtcctggggctgaaccactgcacatggatcgacagg
gcttcgttccggggggtggacctcctcccgatgtaccggcgcttcgcggagcgtcacagg
gaggaggggttcgagacagggggcgaacgaacctgggagaacgactacttcacgagcgcc
cacaaggtgaagttcgacctcttcctgcggttcggactcatcgcagcggcaggggacaga
catctcgcggagttcttccctgtatcctggtacttgaaggaccccgagaccgtgcgctcc
tggaagttcagtctcaccccggtctcctggcgggtggagaatcagaagtcgctcgaggcg
cgggcgcggaggctcgcctccggtgaggaagaggtggagctcgccccgtcgggagaggaa
ggggtcctcatgctgaaggccatcgctggggtggaggagacggtgagcaacgtgaacctt
cccaaccgaggacagatcgccaatctcccgccggggacggtggtggagaccaacgccctc
ttcaggtacgactcggtgcaacccgtccaggccggggcccttccctcttccctcctcggt
catctcacccggcatgtggcacaacaggaaaccatctcgagggccggtctcgagcggaac
tgggacctcgccttcagggccttcctctccgatcctctcgtagcccacctttccccgagc
gaggccgagaggctcttctccctcatgcgagaaaaactctcgccctcgatgcctggctgg
gagtga

DBGET integrated database retrieval system