KEGG   Spirochaeta thermophila DSM 6578: Spith_1407Help
Entry
Spith_1407        CDS       T02016                                 

Definition
glycoside hydrolase family protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
stq  Spirochaeta thermophila DSM 6578
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:stq00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Spith_1407
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    Spith_1407
Enzymes [BR:stq01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Spith_1407
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1576790..1578469
Genome map
AA seq 559 aa AA seqDB search
MSRGGHAPLLLLLLPWMLPAGPASFWDLTEEEIPSFLEAMSDEETISQVFLIGYDGETPD
PRILQWIGRYNLGGIKIFGRNAERLLPVVRSVAAYQEKALAHRSGIPLLVATDQEGGWVR
HIKGETVETPGNMAIGATRLPYEAYQTGLLIGKELRALGITMNFAPTVDVYVNPEAHVIG
PRSFGSDPRLVATLALSFYHGSLDAGVIPVAKHFPGHGNARGDSHGELPVVEDDLATLWE
RDWLPYRILIREGLPAVMVGHLNFPLLSKNDLPATLSSHVISLLREKLDFQGLVITDDLY
MMGARVAGEDIPHIVVEALSAGNDMVLLSRPPHPGDPVWEAVLSRYRNDPEFRKRIQTSV
RRILTLKIRYLKAMGPKGLIPSEETLREAFPDEETAEAFGEQALRAVTMVRSGKVPLSPG
GDARVLLVGQHTRFLSIGKEYFPHADTFQFSYLPFYFASEQVKARLSRLVQQYDLVIYCL
MNPNSLEVLASLEEWGPRIAVLSTLTPVYLAEVPWVDTAVAVYGTSEECYRGGFLALMGK
LTPTGTLPISLTPSSGAPP
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgagtagagggggacacgcccccctccttcttctcctcctcccatggatgctgccggcc
ggtcccgcttcgttctgggacctcacggaggaggagatcccttccttcctcgaagccatg
tccgacgaggaaacgatcagtcaggtcttcctcataggctacgatggcgagacccccgac
ccccggatcctgcagtggatcgggcgctacaacctgggcggcatcaagatcttcgggagg
aacgccgagcgcctcctcccggtggtgaggagtgtggcggcctaccaggaaaaggcgctc
gctcaccgttccggcatccccctcctcgtcgccaccgaccaggagggcggatgggtccgc
cacataaagggggagaccgtagagactcccgggaacatggccatcggcgcgacccgcctc
ccctacgaggcctatcagaccggcctcctcatcggaaaggaattgagggcactggggatc
accatgaacttcgcccccaccgtggacgtgtacgtcaaccccgaagcccacgtgataggg
ccgagatccttcggatcggatccccggctggtcgccacccttgcgctctccttctaccat
gggagcctggacgccggggtgatcccggtggccaaacacttcccgggacacgggaacgcc
cgcggggactcccacggcgagctccccgtggtggaagacgacctggccaccctctgggag
agggactggctcccctatcggatcctcatcagggaggggttgcccgccgtcatggtagga
cacctcaactttccccttctctccaagaacgacctgcccgccaccctctcttcccacgtg
atctctctcctcagggagaaactcgacttccaggggctcgtcatcacggacgacctctac
atgatgggggcccgtgtcgcgggtgaggacatcccccacatcgtggtagaggctctctcg
gcaggcaacgacatggtcctcttgtcacgacctcctcatcccggagacccggtctgggag
gccgtgctgtcgagataccggaacgatcccgagttcaggaaacgaatacagacctccgtg
aggaggatcctcacgctcaagatccgatacctgaaggccatgggaccaaaaggcctcatc
ccctccgaggagaccctgcgggaggccttccccgacgaggaaaccgcggaggcgttcggg
gaacaggccctcagggccgtcaccatggtaaggagcgggaaggtgccgctctcccctgga
ggcgatgcacgagtactcctcgtgggccagcacaccaggttcctctccatcgggaaggaa
tacttcccccatgcggacaccttccagttctcctatctccccttctactttgcctccgaa
caagtgaaggcccgactctcccgtctcgtccagcagtatgatctggtcatctactgtctc
atgaatcccaacagtctcgaggtcctcgcctcgctcgaagaatgggggccacgaatcgcg
gtgctctccaccctcacaccggtgtacctcgccgaggtcccctgggtggacacggcggtg
gccgtatacggtacgagcgaagagtgttaccggggtggcttcctcgccctcatgggcaaa
ctcaccccaacggggacgctccccatctccctcaccccctcctccggagcacctccctga

DBGET integrated database retrieval system