KEGG   Spirochaeta thermophila DSM 6578: Spith_1407Help
Entry
Spith_1407        CDS       T02016                                 

Definition
(GenBank) glycoside hydrolase family 3 domain protein
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
stq  Spirochaeta thermophila DSM 6578
Pathway
stq00520  Amino sugar and nucleotide sugar metabolism
stq01100  Metabolic pathways
stq01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:stq00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Spith_1407
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    Spith_1407
Enzymes [BR:stq01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Spith_1407
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3 Glyco_hydro_3_C
Motif
Other DBs
NCBI-ProteinID: AEJ61671
UniProt: G0GFX8
Position
1576790..1578469
Genome map
AA seq 559 aa AA seqDB search
MSRGGHAPLLLLLLPWMLPAGPASFWDLTEEEIPSFLEAMSDEETISQVFLIGYDGETPD
PRILQWIGRYNLGGIKIFGRNAERLLPVVRSVAAYQEKALAHRSGIPLLVATDQEGGWVR
HIKGETVETPGNMAIGATRLPYEAYQTGLLIGKELRALGITMNFAPTVDVYVNPEAHVIG
PRSFGSDPRLVATLALSFYHGSLDAGVIPVAKHFPGHGNARGDSHGELPVVEDDLATLWE
RDWLPYRILIREGLPAVMVGHLNFPLLSKNDLPATLSSHVISLLREKLDFQGLVITDDLY
MMGARVAGEDIPHIVVEALSAGNDMVLLSRPPHPGDPVWEAVLSRYRNDPEFRKRIQTSV
RRILTLKIRYLKAMGPKGLIPSEETLREAFPDEETAEAFGEQALRAVTMVRSGKVPLSPG
GDARVLLVGQHTRFLSIGKEYFPHADTFQFSYLPFYFASEQVKARLSRLVQQYDLVIYCL
MNPNSLEVLASLEEWGPRIAVLSTLTPVYLAEVPWVDTAVAVYGTSEECYRGGFLALMGK
LTPTGTLPISLTPSSGAPP
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgagtagagggggacacgcccccctccttcttctcctcctcccatggatgctgccggcc
ggtcccgcttcgttctgggacctcacggaggaggagatcccttccttcctcgaagccatg
tccgacgaggaaacgatcagtcaggtcttcctcataggctacgatggcgagacccccgac
ccccggatcctgcagtggatcgggcgctacaacctgggcggcatcaagatcttcgggagg
aacgccgagcgcctcctcccggtggtgaggagtgtggcggcctaccaggaaaaggcgctc
gctcaccgttccggcatccccctcctcgtcgccaccgaccaggagggcggatgggtccgc
cacataaagggggagaccgtagagactcccgggaacatggccatcggcgcgacccgcctc
ccctacgaggcctatcagaccggcctcctcatcggaaaggaattgagggcactggggatc
accatgaacttcgcccccaccgtggacgtgtacgtcaaccccgaagcccacgtgataggg
ccgagatccttcggatcggatccccggctggtcgccacccttgcgctctccttctaccat
gggagcctggacgccggggtgatcccggtggccaaacacttcccgggacacgggaacgcc
cgcggggactcccacggcgagctccccgtggtggaagacgacctggccaccctctgggag
agggactggctcccctatcggatcctcatcagggaggggttgcccgccgtcatggtagga
cacctcaactttccccttctctccaagaacgacctgcccgccaccctctcttcccacgtg
atctctctcctcagggagaaactcgacttccaggggctcgtcatcacggacgacctctac
atgatgggggcccgtgtcgcgggtgaggacatcccccacatcgtggtagaggctctctcg
gcaggcaacgacatggtcctcttgtcacgacctcctcatcccggagacccggtctgggag
gccgtgctgtcgagataccggaacgatcccgagttcaggaaacgaatacagacctccgtg
aggaggatcctcacgctcaagatccgatacctgaaggccatgggaccaaaaggcctcatc
ccctccgaggagaccctgcgggaggccttccccgacgaggaaaccgcggaggcgttcggg
gaacaggccctcagggccgtcaccatggtaaggagcgggaaggtgccgctctcccctgga
ggcgatgcacgagtactcctcgtgggccagcacaccaggttcctctccatcgggaaggaa
tacttcccccatgcggacaccttccagttctcctatctccccttctactttgcctccgaa
caagtgaaggcccgactctcccgtctcgtccagcagtatgatctggtcatctactgtctc
atgaatcccaacagtctcgaggtcctcgcctcgctcgaagaatgggggccacgaatcgcg
gtgctctccaccctcacaccggtgtacctcgccgaggtcccctgggtggacacggcggtg
gccgtatacggtacgagcgaagagtgttaccggggtggcttcctcgccctcatgggcaaa
ctcaccccaacggggacgctccccatctccctcaccccctcctccggagcacctccctga

DBGET integrated database retrieval system