KEGG   Spirochaeta thermophila DSM 6578: Spith_1407Help
Entry
Spith_1407        CDS       T02016                                 

Definition
glycoside hydrolase family protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
stq  Spirochaeta thermophila DSM 6578
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:stq00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:stq00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1576790..1578469
Genome map
AA seq 559 aa AA seqDB search
MSRGGHAPLLLLLLPWMLPAGPASFWDLTEEEIPSFLEAMSDEETISQVFLIGYDGETPD
PRILQWIGRYNLGGIKIFGRNAERLLPVVRSVAAYQEKALAHRSGIPLLVATDQEGGWVR
HIKGETVETPGNMAIGATRLPYEAYQTGLLIGKELRALGITMNFAPTVDVYVNPEAHVIG
PRSFGSDPRLVATLALSFYHGSLDAGVIPVAKHFPGHGNARGDSHGELPVVEDDLATLWE
RDWLPYRILIREGLPAVMVGHLNFPLLSKNDLPATLSSHVISLLREKLDFQGLVITDDLY
MMGARVAGEDIPHIVVEALSAGNDMVLLSRPPHPGDPVWEAVLSRYRNDPEFRKRIQTSV
RRILTLKIRYLKAMGPKGLIPSEETLREAFPDEETAEAFGEQALRAVTMVRSGKVPLSPG
GDARVLLVGQHTRFLSIGKEYFPHADTFQFSYLPFYFASEQVKARLSRLVQQYDLVIYCL
MNPNSLEVLASLEEWGPRIAVLSTLTPVYLAEVPWVDTAVAVYGTSEECYRGGFLALMGK
LTPTGTLPISLTPSSGAPP
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgagtagagggggacacgcccccctccttcttctcctcctcccatggatgctgccggcc
ggtcccgcttcgttctgggacctcacggaggaggagatcccttccttcctcgaagccatg
tccgacgaggaaacgatcagtcaggtcttcctcataggctacgatggcgagacccccgac
ccccggatcctgcagtggatcgggcgctacaacctgggcggcatcaagatcttcgggagg
aacgccgagcgcctcctcccggtggtgaggagtgtggcggcctaccaggaaaaggcgctc
gctcaccgttccggcatccccctcctcgtcgccaccgaccaggagggcggatgggtccgc
cacataaagggggagaccgtagagactcccgggaacatggccatcggcgcgacccgcctc
ccctacgaggcctatcagaccggcctcctcatcggaaaggaattgagggcactggggatc
accatgaacttcgcccccaccgtggacgtgtacgtcaaccccgaagcccacgtgataggg
ccgagatccttcggatcggatccccggctggtcgccacccttgcgctctccttctaccat
gggagcctggacgccggggtgatcccggtggccaaacacttcccgggacacgggaacgcc
cgcggggactcccacggcgagctccccgtggtggaagacgacctggccaccctctgggag
agggactggctcccctatcggatcctcatcagggaggggttgcccgccgtcatggtagga
cacctcaactttccccttctctccaagaacgacctgcccgccaccctctcttcccacgtg
atctctctcctcagggagaaactcgacttccaggggctcgtcatcacggacgacctctac
atgatgggggcccgtgtcgcgggtgaggacatcccccacatcgtggtagaggctctctcg
gcaggcaacgacatggtcctcttgtcacgacctcctcatcccggagacccggtctgggag
gccgtgctgtcgagataccggaacgatcccgagttcaggaaacgaatacagacctccgtg
aggaggatcctcacgctcaagatccgatacctgaaggccatgggaccaaaaggcctcatc
ccctccgaggagaccctgcgggaggccttccccgacgaggaaaccgcggaggcgttcggg
gaacaggccctcagggccgtcaccatggtaaggagcgggaaggtgccgctctcccctgga
ggcgatgcacgagtactcctcgtgggccagcacaccaggttcctctccatcgggaaggaa
tacttcccccatgcggacaccttccagttctcctatctccccttctactttgcctccgaa
caagtgaaggcccgactctcccgtctcgtccagcagtatgatctggtcatctactgtctc
atgaatcccaacagtctcgaggtcctcgcctcgctcgaagaatgggggccacgaatcgcg
gtgctctccaccctcacaccggtgtacctcgccgaggtcccctgggtggacacggcggtg
gccgtatacggtacgagcgaagagtgttaccggggtggcttcctcgccctcatgggcaaa
ctcaccccaacggggacgctccccatctccctcaccccctcctccggagcacctccctga

DBGET integrated database retrieval system