KEGG   Spirochaeta thermophila DSM 6578: Spith_1453Help
Entry
Spith_1453        CDS       T02016                                 

Definition
isochorismatase hydrolase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
stq  Spirochaeta thermophila DSM 6578
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:stq00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1638114..1638722
Genome map
AA seq 202 aa AA seqDB search
MRALIVVDVQNDFVPGGALPVPEGDAVIPVINRLMGRFDVVVATQDWHPATHKSFASNHP
GRSPYEVITLAGLEQVLWPDHCVQGSPGAEFTPGLDLRPVEAIVRKGTDPGIDSYSGFYD
NGRKRSTGLAGYLRERGVREVYVTGLAGEYCVFYTAMDAAAEGFATFVVEDATRPLSAEG
FEKAVVRMREQGITILRSRDVG
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgagagcgctcatcgtcgtggacgtccagaacgatttcgtcccgggaggtgcccttccg
gtgccggaaggcgatgccgtcatcccggtgatcaaccgcctcatgggccggttcgacgtg
gtggtggccacccaggactggcaccctgccacacacaagagcttcgcatcgaatcatccg
gggaggagcccctacgaggtgatcaccctcgcgggcctcgagcaggtgctctggcccgat
cactgcgtgcagggatccccgggcgcggagttcacacccgggctcgacctccgtcccgtg
gaggcgatcgtccgcaaggggacggatcccgggatcgacagttatagcgggttctacgac
aacggccggaaacggagcacgggcctcgccgggtacctgcgggagcggggggtgagggag
gtgtacgtgacggggctcgccggcgagtactgcgtcttctacacggccatggatgcggct
gccgagggattcgccaccttcgtggtggaggacgctaccaggcccctcagcgcggagggc
ttcgagaaggctgtggtccgcatgagggaacaggggatcaccatcctacggtcaagggac
gtgggctga

DBGET integrated database retrieval system