KEGG   Spirochaeta thermophila DSM 6578: Spith_1453Help
Entry
Spith_1453        CDS       T02016                                 

Definition
isochorismatase hydrolase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
stq  Spirochaeta thermophila DSM 6578
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:stq00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Spith_1453
Enzymes [BR:stq01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     Spith_1453
    3.5.1.-  
     Spith_1453
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1638114..1638722
Genome map
AA seq 202 aa AA seqDB search
MRALIVVDVQNDFVPGGALPVPEGDAVIPVINRLMGRFDVVVATQDWHPATHKSFASNHP
GRSPYEVITLAGLEQVLWPDHCVQGSPGAEFTPGLDLRPVEAIVRKGTDPGIDSYSGFYD
NGRKRSTGLAGYLRERGVREVYVTGLAGEYCVFYTAMDAAAEGFATFVVEDATRPLSAEG
FEKAVVRMREQGITILRSRDVG
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgagagcgctcatcgtcgtggacgtccagaacgatttcgtcccgggaggtgcccttccg
gtgccggaaggcgatgccgtcatcccggtgatcaaccgcctcatgggccggttcgacgtg
gtggtggccacccaggactggcaccctgccacacacaagagcttcgcatcgaatcatccg
gggaggagcccctacgaggtgatcaccctcgcgggcctcgagcaggtgctctggcccgat
cactgcgtgcagggatccccgggcgcggagttcacacccgggctcgacctccgtcccgtg
gaggcgatcgtccgcaaggggacggatcccgggatcgacagttatagcgggttctacgac
aacggccggaaacggagcacgggcctcgccgggtacctgcgggagcggggggtgagggag
gtgtacgtgacggggctcgccggcgagtactgcgtcttctacacggccatggatgcggct
gccgagggattcgccaccttcgtggtggaggacgctaccaggcccctcagcgcggagggc
ttcgagaaggctgtggtccgcatgagggaacaggggatcaccatcctacggtcaagggac
gtgggctga

DBGET integrated database retrieval system