KEGG   Spirochaeta thermophila DSM 6578: Spith_1491Help
Entry
Spith_1491        CDS       T02016                                 

Definition
ATPase
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
stq  Spirochaeta thermophila DSM 6578
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:stq00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1673960..1675000)
Genome map
AA seq 346 aa AA seqDB search
MIDRVFPFSAIVGQEEAKQALLLGVIDPGIGGVLLSGEKGTGKTTLVRALASLVPGMPLV
ELPLNTTEDRLVGSLNVEKALSEGVREFEPGLLAAAHRGILYVDEVNLLEHHLVDLLLDV
AATGVNRVEREGISYEHPARFLLVGSMNPEEGDLRPQFLDRFGLAVPVRHLEDPDLRAEV
VRRRLAFETDPAGFCRAWQEEEEVLASQVKAARERLGRVRVAEETYREAVRIAAELGARG
HRAELVMVRAARALASFLEQEEVDASLVRAVARYALFHRVKVGSGESEERVLRRIDAAVD
GRVDEGREEGEVVVEPEDAMVPGAAAAGSLMFEFVKKKLTRWSTNR
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgatcgtgtgtttccgttttcggctatcgtgggccaagaggaggcgaagcaggcc
ctcctccttggggtcatcgatccgggtattgggggtgtgctcctctcaggcgagaagggt
acgggaaagaccacgcttgtgcgagccctcgcctcactcgtgccggggatgcctctggtg
gagctcccgctcaacaccaccgaggacagactggtgggatcgctcaacgtggagaaggcc
ctttccgagggggtgcgtgagttcgagccggggctgctcgccgcggcacaccgggggatc
ctctacgtggatgaggtgaacctccttgagcaccacctggtggatctgctcctcgatgtg
gcggcaacgggggtcaaccgcgtggagcgggaggggatctcctatgagcatccggcgcgg
ttcctgctggtggggtcgatgaaccccgaggagggggatctgaggccgcagtttctcgac
cggttcgggcttgcggtgccggtgcggcatctggaggatccggacttgagggccgaggtg
gtgcggcggaggctggcgttcgagacggatcccgcggggttttgcagggcatggcaggaa
gaggaggaggtgctggcctcgcaggtgaaggcggcgagagagcgtctcgggagggtgagg
gtggccgaggagacctaccgggaggcggtgaggattgcggcggagctcggggcgcgggga
catcgggcggagctggtgatggtgagggccgcccgcgcgctcgcctcgtttctcgagcag
gaggaggtggatgcctcgctggtgagggcggtggcgcggtatgcgttgttccaccgggtg
aaggtggggtcgggtgagagtgaggagcgggtgctgaggaggatcgatgcggcggtggac
gggcgtgtggatgagggtcgggaggagggagaggtggtggtggagcctgaggatgcgatg
gtgccgggggcggcggcggcagggtcgctcatgttcgagttcgttaaaaaaaaactgacg
aggtggtccacgaaccggtag

DBGET integrated database retrieval system