KEGG   Spirochaeta thermophila DSM 6578: Spith_1520Help
Entry
Spith_1520        CDS       T02016                                 

Definition
(GenBank) glycoside hydrolase family 16
Organism
stq  Spirochaeta thermophila DSM 6578
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1700585..1702282)
Genome map
AA seq 565 aa AA seqDB search
MRARLMSWGLVCGLVLVGVIACTSPTGPGTGSEPTPTPTPEPVSGNGDFSEPLSTAEPDA
NGNLDTGGSWAFYLNSGGEATSEIVDEELHVSVTNAGTADWAIQLLQAPVVVERGGTYHI
SFDARASEEGMRVVIKVGGTAERGWTAYYQNTFTLTTGMQTYEADFRMELDTDENARFEV
WFLDTGDYWLDNISLLKTGQEELPTEGTLTETDEDKVENWQLVWSEEFDGPSIDTSIWNF
ETGNGQAQGIPGWGNNELEYYRAENAFIENGVLVIEAREEQVTDEYGTYEYTSARMTTKD
KYEFQYGRVEIRARLPYGQGIWPALWMLGVDIDTNSWPNCGEIDIMELIGSVPNVVHGTV
HGPVSQGPGVGSGYTLETGTFNDDFHVFAMEWDPDEVEFYVDDQLYHVVNKDEIGSDWVF
DHPFFFILNVAVGGNWPGNPDATTVFPQRMEVDYIRVYEDTNPDSIDGQEKWDCDYEIAW
QEPVQIDQVTASEDPEYYLIAEDSTLVDVVIDWDNSALTTGAVMPDVWGSGSTYDAEATY
NWEELLVCDPRHEMEYFCRCARLHG
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atgagagccagattgatgtcatggggtcttgtgtgtgggctggtattggtcggcgtgatc
gcgtgtaccagtcctacgggaccaggtaccgggagtgagcctacgcccacgccaacgcca
gagcctgtctccggcaacggggacttctccgagcccctatccaccgccgagcccgatgcg
aacggcaacctggatacagggggaagttgggccttctacctcaacagcggcggggaggct
acgtcagagatagtggatgaagagctccatgtaagcgtgacgaatgcaggcactgcagat
tgggcgatacagctcctccaggcccctgtggtggtggagcgtggcggcacctaccacatc
agctttgatgcccgggcttcagaagaggggatgcgggtggtgatcaaggtgggaggtaca
gcggagagaggctggaccgcctactaccagaacaccttcaccctcaccacaggcatgcag
acctatgaagccgacttcaggatggagctcgacaccgatgagaacgcacgcttcgaggtg
tggttcctcgacactggtgactactggttggataacatctctcttctgaagacaggtcag
gaggaactccccacagagggtacgcttacagagacagatgaagataaggttgaaaattgg
cagctcgtgtggtctgaagagttcgatggtccctccattgataccagcatctggaacttt
gagacaggtaatggccaagcgcagggcattccgggatggggaaacaacgaactggaatac
taccgggctgagaatgcattcattgaaaatggggttctggtgattgaggcacgagaagag
caggtgaccgatgaatatggtacgtatgagtacacctcggcccgcatgacgaccaaggat
aagtacgagttccagtacggaagggtggagattcgggcgaggcttccctatgggcaggga
atctggcctgcgctgtggatgttgggggttgacatcgataccaattcctggcccaactgt
ggtgagatcgacatcatggagctgatagggagtgtgcccaatgtggtacatggaaccgta
catgggccggtgagccagggaccaggtgtcggttctgggtacaccctcgaaaccggcacg
tttaacgacgacttccatgtgtttgccatggagtgggatcccgacgaggtggagttctac
gtcgacgatcagctctatcacgtggtgaacaaggatgagatcgggtctgactgggtcttc
gatcaccccttcttcttcatcctcaacgtggcggtgggcggtaactggcccggcaatccc
gatgctactacagtcttcccacagcgtatggaggtggactacattcgcgtgtacgaggac
acgaaccccgattccatcgacggccaggagaagtgggactgcgactatgagatcgcctgg
caggaacccgttcagatagatcaagtgacggcaagtgaggatcctgagtactacctcatc
gctgaagattccactcttgtggacgtggtgatagattgggataacagtgctctcacgacc
ggtgctgtgatgcccgatgtgtggggttccggctccacctacgatgctgaggcgacctat
aattgggaagaactgctggtctgtgacccccggcacgagatggagtatttctgcaggtgt
gctcgccttcatgggtga

DBGET integrated database retrieval system