KEGG   Spirochaeta thermophila DSM 6578: Spith_1530Help
Entry
Spith_1530        CDS       T02016                                 

Definition
glycoside hydrolase family protein
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
stq  Spirochaeta thermophila DSM 6578
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:stq00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:stq00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1715634..1717073)
Genome map
AA seq 479 aa AA seqDB search
MFSKTLVPCTILLLHGVLVMSLTSCASRKAEMWMTTTDCSFLLSPVTPISPPASLSFEIS
VDPHTKYQRIMGFGASLTESSGYVISTLPQEDRTALLQALFDPEIGLGLNLLRQPMGSPD
FALSMYTYDDLPEGEEDFPLSRFSIDRDRRFIIPYLKEALGVNPELLIMASPWSPPAWMK
TGQSLIGIEGGRLREDCYEVYARYFVKFVQAYAEEGIPIYAVTPQNEILYAPPTYPGMLM
SAEEQARFVSEALGPAFKAAGLGVKIFCYDHNWDGKDVVLEILRHPDALRYLSGVAWHHY
GGAPSAMSEVHEHFPDLEMWVTEAGNGRWIGRGSFSATFREGMREAIEIFRNHASALILW
NIALDQHNGPIVFENTANHGLVEIVVDSGSRKGRIREPYRSGWYVLGHFSRFVKRGSYRI
ESNTLAGSVGHVAFVTPSGEIVVVVHNPFFSTQRGVVRIGGSSVFLELPSGAAATIVVR
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgttttcgaaaacattagtcccttgtactatcctcctgctccatggcgtgctcgttatg
agtcttacctcctgtgcctcccggaaggcggagatgtggatgaccaccactgattgttcc
ttcctcctctctcccgtcacgcccatatcccctcctgcctcgctttctttcgagatatct
gtagacccacatacgaagtatcagcgaatcatggggttcggggcatcgcttaccgaatcc
tcgggctatgtcatctccaccttgccccaggaagatcggacggccctcctccaggccctc
ttcgatccggagattggtctgggactcaatctccttcgtcaacccatgggatcccctgat
tttgccctctcaatgtacacctatgatgatctgccggagggagaggaggactttccactt
tccagattttccatagatcgggacagacgtttcatcattccctacctcaaagaggcactc
ggggtcaatcctgaactcctcatcatggcctctccctggagccctcctgcctggatgaag
acaggacaaagtctcataggaatagagggaggaaggctgagggaggactgttatgaggtg
tatgctcgctattttgtgaagttcgtccaggcctacgcggaggaaggaattcccatctat
gcggtcacgccgcagaacgagatcctctatgctcctcccacctatccgggaatgctcatg
tcggcagaagaacaggcccggtttgtttcagaggccttgggtcctgcgttcaaggcagcg
ggccttggggtgaagatcttctgctacgatcacaattgggatgggaaggatgttgttctg
gagatcctccgtcaccccgatgccttgcgctacctatcgggggttgcctggcatcactac
gggggagcgccctcagcgatgagtgaggttcatgaacactttcccgaccttgagatgtgg
gtaaccgaggcagggaatgggaggtggattgggcggggttcattttccgccacgttccgt
gaggggatgcgagaggcgatagagatattccgcaaccatgcttcggccctcattctttgg
aatatcgccctcgatcagcacaacggtcccatcgtgtttgagaatactgcgaatcacggt
ctcgtggagatcgtagtcgattcagggagccgaaagggccggatccgtgaaccgtaccgg
tcaggctggtatgtgcttggacacttctctcggttcgtgaagaggggatcgtacaggatc
gaatcgaataccctcgcagggagtgtaggccacgtcgcctttgtaactccttcaggcgag
atcgtggtggtggtgcacaatcccttcttttccacccaacggggggtggttcgcataggg
gggagctctgtattccttgagctgccttccggggctgcagccacgatcgtggtgcgatga

DBGET integrated database retrieval system