KEGG   Spirochaeta thermophila DSM 6578: Spith_1537Help
Entry
Spith_1537        CDS       T02016                                 

Definition
protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
stq  Spirochaeta thermophila DSM 6578
Brite
Enzymes [BR:stq01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Spith_1537
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1725887..1726621
Genome map
AA seq 244 aa AA seqDB search
MPFYAVKKNKPSLKIPLVIRHTTGPVPFPLYLKYNYNMEKDTLIRLLEREGIHERRILDA
IDKVPREEFVPPDQRQYAYENIPLEIGWGQTISQPYTVAFMIQLLELMPGHKVLEVGGGS
GYNAAVMWEVMNHTGELYSMEIHPEVYRMGKANLERTGYTDIRFILGDGSKGLPEEAPFD
RIIVTAAAEETPSTLLSQLGEEGILVIPVHVGGGTSVMTRIQRGGDEFHTTTHGYFRFVP
LVTR
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgcccttctacgctgtcaagaaaaataaaccatctttaaaaataccgttggttattcgc
cacacgacgggtccagttccattcccgctctatttgaagtataactataatatggaaaaa
gataccctcatccgcctcctcgagcgtgaggggattcacgaacggaggatcctcgacgcc
atcgacaaggtccctcgagaagagttcgtaccccctgatcaacggcagtacgcgtacgaa
aacattcccctcgagataggctggggccagaccataagccagccctacaccgtggccttc
atgatccagttgctcgagcttatgccgggacacaaggttctggaagtagggggcggctcg
ggctacaacgccgccgtcatgtgggaggtgatgaaccacacgggagagctgtactcgatg
gagatccatccagaggtgtaccggatgggaaaggccaacctcgaacgtacggggtacacc
gacattcgcttcatcctgggggatggctcgaaggggctcccggaagaggcgcccttcgac
cgcatcatcgtgacagccgcagccgaggagacgccttccaccctgctctctcagctcgga
gaagaaggaatcctcgtcatccctgtacacgtgggcgggggcacgtcggtcatgacccgc
atccagcgcgggggcgacgagttccacaccaccactcacggctacttcaggttcgtgccg
ctcgtgacgcggtga

DBGET integrated database retrieval system