KEGG   Spirochaeta thermophila DSM 6578: Spith_1689Help
Entry
Spith_1689        CDS       T02016                                 

Definition
Xylose isomerase
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
stq  Spirochaeta thermophila DSM 6578
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:stq00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:stq00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1896604..1897926)
Genome map
AA seq 440 aa AA seqDB search
MINEFFKNISKIPYEGPGSDNPLAFKYYNPDEVIGGKPLKEHLRFALAYWHTLNGSGQDP
FGVGTMIRPWLSISDPMEQAKARMRACFEIAEKLEIPFFCFHDRDIAPEGTTLRETNKLL
DEVVEYTKDLMKDSPVKLLWGTANLFSHPRYVHGASTSPNAEVFAYAAAQVKKALEVTLY
LDGQNYVFWGGREGYETLLNTNMQLELDNLARFLHMAVDYAKKIGFKGQFLIEPKPKEPT
KHQYDFDVAAVYGFLRKYDLLPYFKVNIEMNHATLAYHTFQHELHFARINGILGSMDVNQ
GDYLLGWDTDQFPTNIYETTLAMYEVIKNGGIAPGGLNFDAKVRRGSFEPEDIFIAHIAG
MDAFARGFKVAWKLLEDKAIEKHVEERYASYREGIGKKIVEGKVGFEDLEAYIIDKAEIK
NASGRQELLEAVLNRYLLEA
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgatcaatgaatttttcaagaacatctcaaagatcccttacgagggaccgggatccgat
aatcccctcgcgttcaagtactacaaccccgatgaggtgatcggtggcaagccgctcaag
gagcacctccgcttcgcccttgcctactggcacaccctcaacgggagcgggcaggacccc
ttcggggtgggcaccatgatccgtccatggctctcgatctccgatcccatggagcaggcc
aaggccaggatgcgggcctgtttcgagatcgcggagaagctggagatccccttcttctgc
tttcacgacagggacatcgcacccgaggggaccacgctcagggagaccaataagctcctg
gacgaggtggtcgaatacaccaaggacctcatgaaggacagccctgtgaagctcctgtgg
ggaaccgcgaacctcttcagccatccgcgttacgtgcatggggcatccacctcgcccaac
gccgaggtcttcgcctatgcggcggcccaggtcaagaaggcgctcgaggtgaccctgtac
ctggacggccagaactacgtgttctggggcggtcgcgaagggtacgagaccctgctcaac
acgaacatgcagctcgagctcgacaacctcgcccgcttcctccacatggcggtggactac
gccaagaagatagggttcaaggggcagttcctcatcgagccgaagcccaaggagcctacc
aagcaccagtacgatttcgacgtggctgcggtgtacgggttcctcaggaagtacgacctc
ctgccctacttcaaggtgaacatcgagatgaatcatgcgaccctggcctatcacaccttc
cagcacgaactccacttcgcccggatcaacgggatcctggggagcatggacgtcaaccag
ggtgactacctcctcggatgggacaccgatcagttccccacgaacatctacgagaccacc
ctcgcgatgtacgaggtgatcaagaacggcgggatcgctcccggtgggctcaacttcgac
gccaaggtgcggcggggatccttcgagcccgaggatatcttcatcgcccacatcgccggc
atggatgcctttgcacgggggttcaaggtggcctggaagctcctcgaggacaaggccata
gagaagcacgtggaggagcggtacgcgagctaccgtgagggcatcggcaagaagatcgtc
gagggcaaggtgggattcgaagacctcgaagcctatatcatcgacaaggcagagataaag
aacgcctccggcaggcaggagctcctggaggccgtcctcaaccggtatctgctcgaagcc
tga

DBGET integrated database retrieval system