KEGG   Spirochaeta thermophila DSM 6578: Spith_1713Help
Entry
Spith_1713        CDS       T02016                                 

Definition
3-oxo-5-alpha-steroid 4-dehydrogenase domain-containing protein
Orthology
K12343  
3-oxo-5-alpha-steroid 4-dehydrogenase 1 [EC:1.3.1.22]
Organism
stq  Spirochaeta thermophila DSM 6578
Brite
Enzymes [BR:stq01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     Spith_1713
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1929804..1930541)
Genome map
AA seq 245 aa AA seqDB search
MYERLVLVWMALAVAVWILLSQVTAPYGRHVRQGWGTPLNARMAWMVMELPSLLIPLYGL
LWGRPEGLAAFFLGLWVFHYAYRSLLFPFLIRARKDVPFSVVGMALVFNLANSGFNTYSL
LFVKDYASSWTSDPRFLLGVCLFLSGFVMHVVSDARLRALRREGEGSYRIPQGWLFRWVS
CPNYFGEILEWTGWALATWSLAGISFALWTCANLVPRALSHHRWYRQHFPDYPADRKALI
PVIGP
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgtatgagcgtctcgtccttgtctggatggccctcgcggtggcggtgtggatcctgctc
tcacaggtgacggctccctacggcagacacgtgcgccaggggtggggaacaccgctcaat
gcccggatggcgtggatggtgatggaactcccttccctcctcatcccgctctacgggctt
ctgtggggaagaccggaagggctggccgcctttttcctggggctctgggtctttcactat
gcctatcggagcctcctcttccccttcctcatcagggcacgcaaggacgttcctttctcc
gtggtggggatggccctcgtgttcaacctcgccaacagcgggttcaacacctactcgctt
ctcttcgtgaaggactatgcctcctcgtggacctcggatccccgttttctcctgggagtc
tgcctcttcctctcggggttcgtgatgcacgtggtctccgatgcacggctcagggccctc
agaagggaaggggaggggagctaccgtatccctcaggggtggctcttccggtgggtctcg
tgtcccaactacttcggtgagatcctcgagtggacggggtgggccctcgccacctggtcg
ctcgcggggatctccttcgcactctggacgtgtgccaacctcgtgcctcgggctctctcc
caccacaggtggtacaggcagcacttcccggactatcccgcggaccgcaaggccctcatc
cccgtgatagggccttga

DBGET integrated database retrieval system