KEGG   Spirochaeta thermophila DSM 6578: Spith_1890Help
Entry
Spith_1890        CDS       T02016                                 

Definition
acetylornithine deacetylase/succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
stq  Spirochaeta thermophila DSM 6578
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:stq00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Spith_1890
  Amino acid metabolism
   00300 Lysine biosynthesis
    Spith_1890
Enzymes [BR:stq01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Spith_1890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2116412..2117680)
Genome map
AA seq 422 aa AA seqDB search
MHEDTSKRMLSYMEAHTEEMVELQRLLTSHPALSPEVGGRGEWEKAQALVEWLEAHLLRE
AREKGVAASLSVVEVPDERAERGSRPSILVELWHDRNGPAFWIMTHLDVVPPGEVALWNG
DPFTAVVKEGRIYGRGTEDNQQSMTSSIFAARALVALGLAPERPLKLLFVADEEFGNRYG
IQALVTSHRSLFKEGDVFLVPDGGLPDGSMIEVAEKQLLWLKFTTRGRQCHASRPDLGKN
AFVAASDLVVRLSRLDERFPRRNDLFVPPCSTFVPSRKDPNVPNINTVPGEDVFYMDCRV
LPEVDLAEVMGAVEALCREVEAAYGVEISVEVVQRIVSRPTPADAPLVDALKAAVEEVYG
VEARPMGIGGGTVAAPLRNEGFDCVVWSTVDETAHQPNEYCVIEHMVKDAGVMALLALRF
RR
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgcacgaggatacgagcaagaggatgctttcctacatggaggcacacaccgaggagatg
gtcgagctgcagcggctgctcacctctcaccccgccctctcgcccgaggtgggtggtcga
ggagagtgggagaaggcccaggccctcgtcgagtggctggaggcccatctcctgcgcgag
gcgcgcgagaagggggtggcggcatccctctcggtggtggaggtgcctgacgagcgggcc
gaacgcggttccaggccttcgatcctggtggaactctggcacgacaggaacggacctgcc
ttctggatcatgacgcacctcgacgtggtgccgccgggcgaagtcgcactgtggaacggg
gatcccttcaccgcggtggtaaaggaggggcgtatctacggacggggaaccgaggacaac
cagcagtcgatgacgagttcgatcttcgcggcgcgtgccctggtggccctcggccttgcg
cccgagcggcccctgaagctcctcttcgtggcggacgaggagttcggcaaccgttacggt
atccaggcgctcgtgacctcccacaggagtctcttcaaggagggggacgtgttcctggtg
ccggacgggggactccccgacggctccatgatcgaggtggcggagaagcagctcctgtgg
ctcaagttcaccacacggggacgccagtgccatgcctcgaggcccgatctggggaagaac
gccttcgtggcggcttcggatctggtggtgaggctctcccggctcgatgagcggttcccc
cggcggaacgatctgttcgtgcctccctgttccaccttcgtgccttcccgtaaggacccc
aacgtgcccaacatcaacaccgtgccgggcgaggacgtgttctacatggactgccgggtg
ctcccggaggtggaccttgccgaggtcatgggggcggtcgaggccctctgccgcgaggtg
gaggcggcctacggcgtcgagatctcggtggaggtggtgcagcggatcgtctcgaggccc
acacccgcggatgccccgctcgtggatgccctgaaggccgcggtggaggaggtctacggt
gtcgaggcgcgtcccatggggataggagggggcacggtggccgctccccttcggaacgag
gggttcgactgtgtggtgtggtcgaccgtggacgagaccgctcaccagcccaatgagtac
tgcgtcatcgagcacatggtgaaggacgcgggggtcatggcccttcttgcactacgtttt
cgcagatga

DBGET integrated database retrieval system