KEGG   Spirochaeta thermophila DSM 6578: Spith_1921Help
Entry
Spith_1921        CDS       T02016                                 

Definition
tryptophan synthase subunit beta
Orthology
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
stq  Spirochaeta thermophila DSM 6578
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:stq00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Spith_1921
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Spith_1921
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Spith_1921
Enzymes [BR:stq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Spith_1921
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2150825..2152177)
Genome map
AA seq 450 aa AA seqDB search
MQRKILLSEKDLPSHWYNILADLPGGPLDPPLHPVTKQPLSPDELSALFPRALIEQEMSG
ERWIEIPEEVRKILALWRPTPLYRAYQLEQALETPARIYFKWEGASPPGSHKPNTSVAQA
YYNRKEGITRLTTETGAGQWGSSLAFAGRLFGMEVRVYMVKVSYEGKPYRRIMMETWGAE
CIPSPSPRTKVGKAILEKDPDSPGSLGIAISEAVEEAVEREDTHYALGSVLNHVLLHQTV
IGLECRKQLELASDYPDVVIGCVGGGSNFGGIALPFAYDKIHGKDVRLVAVEPSACPTLT
KGVYTYDYGDTGKMTPIVRMHTLGHDFVPPGIHAGGLRYHGMAPIVSRLVKEGVVEARAY
HQRAVFEAAVLFARTEGFIVAPETAHAIKACVDEALAAKEEGKERVILVNASGHGHFDMA
AYQQYFEGRLEDYEYPEEKIREALSALPQV
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgcaaagaaaaatcctgctcagtgaaaaggatcttccctcgcactggtacaacatcctc
gcggacctgccgggtgggccgctcgacccgcccctccatccggtcacgaagcagccgctc
tcgccggatgagctctccgccctcttcccccgggccctcatcgaacaggagatgagcggc
gagcggtggatcgagattcccgaggaggtgcggaagatcctcgccctctggcggcccacg
ccgctctaccgggcctaccagcttgaacaggccctcgagaccccggctcgtatctacttc
aagtgggagggtgcctctcctccgggttcccacaagcccaatacctcggtggcccaggcc
tactacaacaggaaggaagggatcaccaggctcaccacggagacgggggcgggccagtgg
gggagcagcctcgccttcgcgggcaggctcttcgggatggaggtgcgggtctacatggtg
aaggtgagctacgagggcaagccctacaggcgcatcatgatggagacgtggggcgccgag
tgcatacccagtccctcaccccgcaccaaggtgggcaaggccatcctcgagaaggatccc
gactcgcccggttccctcggtatcgccataagcgaggccgtggaggaggcggtggaacgg
gaggacacccactacgccctcggttcggtgctcaaccacgtgctgctccaccagaccgtg
atcggcctcgagtgcaggaagcagctcgaactcgcgagtgactatcccgatgtggtcata
ggctgtgtgggtgggggatcgaacttcgggggtatcgcccttcccttcgcctacgacaag
atccatgggaaggacgtacgcctcgtggcggtggagccgtcggcgtgtcccaccctcacc
aaaggggtctatacgtacgactacggcgacacggggaagatgacccccatcgtgaggatg
cacaccctggggcacgacttcgtcccgccgggcatccatgcaggaggcctgcggtatcac
ggcatggcgcccatcgtctcacgtctggtgaaggagggggtggtcgaggcccgtgcctac
catcagagggcggtcttcgaggccgcggtcctcttcgcccgcaccgaggggttcatcgtg
gcgcccgagacggcccatgcgatcaaggcctgcgtggacgaggccctcgcggcgaaggaa
gaagggaaggagcgggtcatcctggtgaacgcatcgggtcacgggcacttcgacatggcg
gcctaccagcagtacttcgagggcaggctcgaggattacgagtatcccgaggagaagatc
agggaggcgctctcggcgctcccccaggtctga

DBGET integrated database retrieval system