KEGG   Spirochaeta thermophila DSM 6578: Spith_2109Help
Entry
Spith_2109        CDS       T02016                                 

Definition
glycoside hydrolase family protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
stq  Spirochaeta thermophila DSM 6578
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:stq00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2361980..2363566
Genome map
AA seq 528 aa AA seqDB search
MRVGRWIVIVLLSLGLIVGCAFPFLGNVEKEENTSSRATSLSVGRLTGVNWFGFETGNYV
VHGLWARDYKSMLKQIADLGFNCIRIPWANEMIGKAPNSIQINPSGVDPYTGEQGLNLDL
EGLSSLEVLDKIIEEANRLGLYVILDNHSRAADGYMNETLWYTDEYPEERWISDWVMMVR
RYKNYPNVIGADLNNEPHGNTGTGMKPPATWGYTLPEYGDTDWKAAAERCAAAILAENPN
LYIIVEGVEEYQGDTYWWGGNLKGVRDYPITSIPAENLIYSPHEYGPEVYNQAWFSDPTF
PDNMPAIWDEHFWFIYKENIAPVLIGEFGIKEESAADPSSVAYQWFTTFMAYVGNKASWT
FWCMNPNSGDTGGILKDDWVTVNEAKYNLIRPYLANPPQPTATPTPTSTPTPTPTPTPTP
TPTPTPTPTPTPTATPTPTPTPSGEYTEITLPFTYDGGGEYYWKTHQFSTDPNDWSRYVN
SWNLDLLEINGTDYTNVWVAQHQIPAASDGYWYIHYKSGVSWGHVEIK
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgtaggccgatggatagtgatcgtgcttttgagtcttggattgatagtaggatgt
gcgttccccttcctcgggaatgttgaaaaggaggagaacacctcttcccgagccactagc
ctttcagtcggtcgtcttacaggtgtgaactggttcgggttcgagaccggcaactacgtg
gtgcacgggctctgggccagggactacaagtccatgctcaagcagatagcggatctcggg
ttcaactgtatcagaatcccgtgggccaacgagatgataggtaaggcaccgaacagcatt
cagatcaatccctcgggtgtggatccctacaccggggagcagggactcaatctggatctc
gaagggctttcgtccctcgaggtgctcgacaagatcattgaggaggccaaccgtctcggt
ctctacgtgatcctcgacaaccactcccgggccgctgatggctatatgaacgaaaccctc
tggtataccgacgagtatcctgaggagaggtggatctcggactgggtgatgatggtgcgt
cggtataagaactaccccaatgtgataggagccgatctcaacaacgagccgcacgggaat
accgggaccgggatgaagccgccggctacgtggggatacaccctccccgagtacggcgat
accgattggaaggcagctgccgagcggtgtgctgcggccatccttgcggagaacccgaat
ctctacatcatcgtggaaggggtagaggagtatcagggcgatacctactggtggggcggc
aatctcaaaggcgtgagggactatcccatcacctccatccctgcggagaacctcatctat
tctccccatgagtatgggcccgaggtctacaatcaggcctggttcagcgatcctaccttt
ccggacaacatgcctgcgatctgggatgagcacttctggttcatctacaaggagaacatc
gcccccgtactcataggggagttcggcatcaaggaggagtctgctgctgatccctcctcg
gttgcctaccagtggttcaccactttcatggcctatgtgggaaacaaggcctcgtggacg
ttctggtgcatgaatcccaactcgggggatacgggaggcatcctcaaggacgactgggtg
acggtgaacgaggcgaagtacaacctcatcaggccctatctggccaatccgccgcagccc
acggccacacccactcctaccagcacgccgacacccactcctacgccgacgcctactccc
acgcccactcctactccgactcccactccgacgcctactgccacacctacgcctactccc
acaccttccggggagtacaccgagatcacgcttcccttcacctacgatggggggggtgag
tactactggaagacccaccagttctccacggatccgaacgactggagccgatacgtgaac
tcgtggaacctggacctgctggagatcaacgggaccgactataccaacgtatgggtggcg
cagcaccagataccagcagcctcggacggctactggtacatccactacaagagcggcgtc
tcgtggggacatgtggagataaagtga

DBGET integrated database retrieval system