KEGG   Spirochaeta thermophila DSM 6578: Spith_2278Help
Entry
Spith_2278        CDS       T02016                                 

Definition
Recombination protein recR
Orthology
K06187  
recombination protein RecR
Organism
stq  Spirochaeta thermophila DSM 6578
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:stq00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Spith_2278
DNA repair and recombination proteins [BR:stq03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Spith_2278
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2540578..2541186)
Genome map
AA seq 202 aa AA seqDB search
MNSLEVLIGHLSRLPGVGKKSASRIAHWLLKADRAFVQALGRLIMELPDRVKRCSRCGMY
SDATLCEICSDPARDHRTICVVEQPSDVWAIEATHTYRGLYHVLHGAIAPLEGVRPEDLT
IDALVRRLEREPVEEVIIATNPTVEGDTTALYLVRLLKDWGGKVSRLALGLPVGGDLEYA
DRVTLARALEGRQRISSGEGDG
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgaactccctcgaggtgctcatcggccatctctcccgtctcccgggggtggggaagaag
agtgcgagcaggatcgcccattggttgctcaaggcggacagggcgttcgtacaagccctg
ggtcggctcatcatggagctcccggatcgcgtgaagcggtgcagccggtgtggcatgtac
tcggatgcgactctctgcgagatatgtagtgacccggcacgtgaccataggaccatatgt
gtggtggaacagccctctgatgtgtgggcgatcgaagcgacgcatacgtacaggggcctc
tatcacgtcctgcacggcgccatcgcccccctggagggggttcgccccgaggatctcacc
atcgatgccctcgtgagacgcctcgagagggaaccggtggaagaggtgatcatcgccacc
aatcccacggtggagggcgataccaccgccctctatctcgtcaggctcctcaaggactgg
ggggggaaggtctcccgtctcgcactgggactcccggtgggtggtgacctcgagtacgcc
gacagggtcacgctcgcgcgggcgcttgagggccgtcagcgcatttcctccggggagggg
gacggatga

DBGET integrated database retrieval system