KEGG   Spirochaeta thermophila DSM 6578: Spith_2278Help
Entry
Spith_2278        CDS       T02016                                 

Definition
Recombination protein recR
Orthology
K06187  
recombination protein RecR
Organism
stq  Spirochaeta thermophila DSM 6578
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:stq03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2540578..2541186)
Genome map
AA seq 202 aa AA seqDB search
MNSLEVLIGHLSRLPGVGKKSASRIAHWLLKADRAFVQALGRLIMELPDRVKRCSRCGMY
SDATLCEICSDPARDHRTICVVEQPSDVWAIEATHTYRGLYHVLHGAIAPLEGVRPEDLT
IDALVRRLEREPVEEVIIATNPTVEGDTTALYLVRLLKDWGGKVSRLALGLPVGGDLEYA
DRVTLARALEGRQRISSGEGDG
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgaactccctcgaggtgctcatcggccatctctcccgtctcccgggggtggggaagaag
agtgcgagcaggatcgcccattggttgctcaaggcggacagggcgttcgtacaagccctg
ggtcggctcatcatggagctcccggatcgcgtgaagcggtgcagccggtgtggcatgtac
tcggatgcgactctctgcgagatatgtagtgacccggcacgtgaccataggaccatatgt
gtggtggaacagccctctgatgtgtgggcgatcgaagcgacgcatacgtacaggggcctc
tatcacgtcctgcacggcgccatcgcccccctggagggggttcgccccgaggatctcacc
atcgatgccctcgtgagacgcctcgagagggaaccggtggaagaggtgatcatcgccacc
aatcccacggtggagggcgataccaccgccctctatctcgtcaggctcctcaaggactgg
ggggggaaggtctcccgtctcgcactgggactcccggtgggtggtgacctcgagtacgcc
gacagggtcacgctcgcgcgggcgcttgagggccgtcagcgcatttcctccggggagggg
gacggatga

DBGET integrated database retrieval system