KEGG   Sebaldella termitidis: Sterm_0050Help
Entry
Sterm_0050        CDS       T01123                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
str  Sebaldella termitidis
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:str00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Sterm_0050
Enzymes [BR:str01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Sterm_0050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(56363..57511)
Genome map
AA seq 382 aa AA seqDB search
MQTNISILGATGSIGKNALSIIRENRDKFNITALSADKNWQALAENIREFKPKYVSVGTQ
EGYDSIKREFPNIEIFMGCEGLKNIGQLDETDILLTAVSGSIGLPATVEAIKKEKRIALA
NKETMVAGGYLIRDLLKKYNSEIIPVDSEHSAVFQSLKAGSHNEIERIILTASGGPFRGA
DKKFLENVTLEQALKHPNWSMGAKITIDSSTLVNKGLEVIEAHHLFLVDYDKIDVIIHPQ
SIIHSMVEFRDKSVIAQMGEPDMKTPILYAFTYPERVENKLLGNFDFMKFNNITFEKADF
EVFKGLKLAYDAGKQGESYPIVYNAANEAAVDLFMNRKINYTDIYKIIEDELNTHKSVKS
LDLDVIMDVDREIKNKIYNLYE
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgcaaacaaacatttcaatactgggggctactggaagcattggtaaaaatgccctttca
ataatacgtgaaaatcgtgacaaatttaatattactgctctttcagcggacaaaaactgg
caggcactggcagaaaacatcagggaattcaaaccaaaatatgtatctgtgggaacacag
gaaggatatgacagtataaaaagagaatttccgaatatagagatttttatgggttgtgaa
ggattgaaaaatataggacagcttgatgaaactgatattttattaactgcggtaagcgga
tccataggacttccggctactgtggaagctataaaaaaagaaaaaagaatagctctggca
aataaagaaactatggttgcaggaggttatcttatacgtgatcttctaaaaaaatataac
tcggaaattattcccgtggacagtgaacacagtgctgtttttcagtcattaaaagcaggc
agccataatgaaatagaaagaattattcttactgcttcaggaggaccattcagaggtgcc
gataaaaaattccttgaaaatgtcactctggaacaggcgttaaaacatccaaactggagc
atgggtgccaagattactattgattcttccactcttgttaataagggactggaagtaata
gaagcccatcatctttttttggttgattatgataaaattgatgttataatacatccgcag
agtattatccattctatggtagaattcagggataaatccgttattgcacagatgggagag
cctgacatgaaaactcctattctttacgcctttacctatcccgaaagagtggagaacaaa
ctgcttgggaactttgattttatgaagttcaataatattacttttgaaaaagccgatttt
gaagttttcaaaggtcttaagctggcatatgatgcgggaaaacagggagaatcttatcct
attgtatataatgccgcaaacgaagctgctgtagacctgtttatgaacagaaaaatcaat
tatactgatatctacaaaattatagaagatgaactaaatacacataaatcggttaaatct
ctggatcttgatgttattatggatgtagacagagaaataaaaaataaaatttataattta
tatgaataa

DBGET integrated database retrieval system