KEGG   Sebaldella termitidis: Sterm_0094Help
Entry
Sterm_0094        CDS       T01123                                 

Definition
(GenBank) 4-diphosphocytidyl-2C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
str  Sebaldella termitidis
Pathway
str00900  Terpenoid backbone biosynthesis
str01100  Metabolic pathways
str01110  Biosynthesis of secondary metabolites
str01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:str00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Sterm_0094
Enzymes [BR:str01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Sterm_0094
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C FadA
Motif
Other DBs
NCBI-ProteinID: ACZ06979
JGI: Sterm_0094
UniProt: D1AJS2
Position
102954..103811
Genome map
AA seq 285 aa AA seqDB search
MIYSNCKINLGLNILKKREDGYHELDMVMMPVDFNDVLKYEDYGEKGDLILEVSDTRIPI
DEKNIVRKAYNLYFDNSNTPRQKIKVFLDKKIPHEAGLGGGSSNAAFILRKLNDKYKLYT
NEELEKIALKVGADVPFFIRNKSARVTGIGEKIEEIENNLSSEILLIKPQQGMSTGQVYS
YYKDNKKDLKMADIMSIVKALKENNLTQLLKNIENSLEQLIFKKDSSFRDLKNELEDALA
KKIFLSGSGSCFFAFCENGNFDTSKLDKKNVFYQKTNRLVQNYGK
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgatatattcgaactgtaagatcaatctgggattgaatatcctgaaaaaaagagaagac
gggtatcatgaactggatatggtaatgatgcctgtggattttaacgatgtgttgaaatat
gaagattacggggaaaaaggcgacctgatactggaagtcagtgatacaagaataccgata
gatgaaaaaaatatagtgagaaaagcatataatctgtattttgataactctaacaccccg
agacaaaaaataaaagtatttttggataaaaaaataccgcatgaagccggactcggcgga
ggcagctccaatgcagcttttatactcagaaagctgaatgacaagtataagctgtatact
aatgaagagttggaaaaaatagctctaaaggtaggagcagacgtaccgttttttataaga
aataaaagtgcaagggtaacagggatcggcgaaaaaatagaagagatagaaaataatctg
tcatcagaaatacttcttataaaaccgcagcaggggatgtcaacagggcaggtctacagt
tattacaaagataataaaaaagatctgaaaatggcggatattatgagtatagtaaaggct
ctgaaagaaaataacctgactcagcttttaaaaaatatagaaaattcactggaacagctt
atctttaaaaaagacagcagcttcagagatttgaaaaatgaattggaagatgctttggcc
aaaaagatatttttatcaggaagcggaagctgcttttttgcattttgcgaaaacggaaat
tttgatacaagtaaacttgataaaaaaaatgttttttatcaaaaaacgaacaggctagtg
caaaattatggaaaataa

DBGET integrated database retrieval system