KEGG   Sebaldella termitidis: Sterm_0094Help
Entry
Sterm_0094        CDS       T01123                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
str  Sebaldella termitidis
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:str00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
102954..103811
Genome map
AA seq 285 aa AA seqDB search
MIYSNCKINLGLNILKKREDGYHELDMVMMPVDFNDVLKYEDYGEKGDLILEVSDTRIPI
DEKNIVRKAYNLYFDNSNTPRQKIKVFLDKKIPHEAGLGGGSSNAAFILRKLNDKYKLYT
NEELEKIALKVGADVPFFIRNKSARVTGIGEKIEEIENNLSSEILLIKPQQGMSTGQVYS
YYKDNKKDLKMADIMSIVKALKENNLTQLLKNIENSLEQLIFKKDSSFRDLKNELEDALA
KKIFLSGSGSCFFAFCENGNFDTSKLDKKNVFYQKTNRLVQNYGK
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgatatattcgaactgtaagatcaatctgggattgaatatcctgaaaaaaagagaagac
gggtatcatgaactggatatggtaatgatgcctgtggattttaacgatgtgttgaaatat
gaagattacggggaaaaaggcgacctgatactggaagtcagtgatacaagaataccgata
gatgaaaaaaatatagtgagaaaagcatataatctgtattttgataactctaacaccccg
agacaaaaaataaaagtatttttggataaaaaaataccgcatgaagccggactcggcgga
ggcagctccaatgcagcttttatactcagaaagctgaatgacaagtataagctgtatact
aatgaagagttggaaaaaatagctctaaaggtaggagcagacgtaccgttttttataaga
aataaaagtgcaagggtaacagggatcggcgaaaaaatagaagagatagaaaataatctg
tcatcagaaatacttcttataaaaccgcagcaggggatgtcaacagggcaggtctacagt
tattacaaagataataaaaaagatctgaaaatggcggatattatgagtatagtaaaggct
ctgaaagaaaataacctgactcagcttttaaaaaatatagaaaattcactggaacagctt
atctttaaaaaagacagcagcttcagagatttgaaaaatgaattggaagatgctttggcc
aaaaagatatttttatcaggaagcggaagctgcttttttgcattttgcgaaaacggaaat
tttgatacaagtaaacttgataaaaaaaatgttttttatcaaaaaacgaacaggctagtg
caaaattatggaaaataa

DBGET integrated database retrieval system