KEGG   Sebaldella termitidis: Sterm_0276Help
Entry
Sterm_0276        CDS       T01123                                 

Definition
PfkB domain-containing protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
str  Sebaldella termitidis
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:str00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Sterm_0276
Enzymes [BR:str01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Sterm_0276
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
301430..302344
Genome map
AA seq 304 aa AA seqDB search
MKEKKAVIIGSLNYDIILKQKRLPKIGETFVADSITMCGGGKGANQAVQLSKLGGKAFMA
GCVGNDKFGEELLSNLQKHNVNTDNVKLSEKNNTGMGIVNVFDDGKLIATITRGANYDIT
NSDIDKIKNEIISAQIIILQMEIPIEVIEYVINLASKHDVYIILNAAPACEIKEEVLSKV
NCLVVNETEASFYLNKEINDVKSSIENCEELYGKIKDLLIITLGENGSLLYDGKEKLHIK
ARKAEVTETTGAGDSFIGAFAYKLLNDSSYKEAAEFASLVSSITVTKIGAQDSMPTYEEV
KKFL
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaaggaaaagaaagcagttattattggaagcttaaattatgatattattttgaaacaa
aaaagactgcctaaaataggcgagacatttgtagctgacagtataacaatgtgcgggggc
ggaaaaggagccaatcaggcagtacagctttctaaattaggcggaaaagcttttatggca
gggtgtgtcggaaatgacaaatttggtgaggaattactttcgaatttgcaaaagcataat
gtaaataccgataatgtaaagttatcagagaaaaataatacaggcatgggtatagtgaat
gtattcgatgacggtaagcttattgcaacaataaccagaggagcaaattacgatattaca
aattcagatatagataaaataaaaaatgagataataagtgctcaaataataatacttcag
atggaaataccgattgaagtgatagaatatgtcataaatcttgcgagcaagcatgatgtc
tatattatattaaatgcagcaccggcatgtgagatcaaagaagaggtgctgtctaaggta
aactgtcttgtagtgaatgaaacggaagcttctttttatctgaataaagaaattaatgac
gtcaaatcgtccatagaaaactgtgaagaattatacggaaaaataaaagatcttcttata
ataactctgggagaaaacggaagcctgctgtatgacggaaaagaaaaactgcatataaag
gcaagaaaagcggaagtaacagaaacaacaggtgcaggcgactcatttataggagccttt
gcatataagctcttaaatgattcttcctataaagaagcagctgagtttgcatcacttgta
agttctataaccgtgacaaaaataggagcacaggattctatgcctacatatgaggaagta
aagaaatttttataa

DBGET integrated database retrieval system