KEGG   Sebaldella termitidis: Sterm_0374Help
Entry
Sterm_0374        CDS       T01123                                 

Definition
asparagine synthase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
str  Sebaldella termitidis
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:str00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
427658..429244
Genome map
AA seq 528 aa AA seqDB search
MCGFVFTSYEGTKQKEFDKGFQKIYHRGPDNESVTVQRGGIWGFHRLAIMDLSNRGNQPF
MHNGSELMCNGEIFNYQELEKLVKDIYEFHSESDCEVLLPLYEKFGIEIMVKMLDAEFAM
VLYDGKTGEVMAARDPIGIRPLFYGFEKETGKISFSSEAKGLIDFCKGVKPFPPGHYYKD
GEFHSYNDIADPKVIVDEEIETITKKIKDKLEAAVIKRLHSDAPIGFLLSGGLDSSLVCA
IAQKHLKKPIKTFAIGMETDPIDLKYAGEVAEYLGTEHTEVRIAKDDVLGALRDVIYHLE
SWDITTVRASIGMYLICKYIHENTGLKVLLTGEVSDEIFGYKYTDFAPTPAEFQKEAQKR
IRELYLYDVLRADRCIAAHSLEARVPFGDIDFVNYVMSVNPEKKMNKYNKGKYLLRKAFE
GEGYLPDSILYREKAAFSDAVGHSMVDYLKEYAEAKYSEEDLKNAADKYPYKTPFTKESL
LYREIFEEFYPGNADWIKDFWMPNREWEGCRVDDPSARVLSNYGDSGK
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggatttgtatttacgtcatatgaggggacaaagcagaaagaatttgataaggga
tttcagaagatatatcaccgcggtccggataatgaaagtgtaacagtacagaggggcggt
atatggggcttccacaggctggcaattatggatctgagcaacaggggaaatcagccgttt
atgcataacggcagtgaattgatgtgcaacggagaaatatttaactatcaggagctggaa
aaattagtaaaggatatatatgaatttcattcagaaagtgactgtgaagtacttcttccg
ctttatgaaaaattcggaatagagattatggtaaaaatgcttgatgcagaatttgcaatg
gtattgtatgacgggaaaaccggagaggtaatggcagcaagagatccgataggaataaga
cctttattttacggttttgaaaaagagacaggcaaaatttcattttcaagtgaggcaaaa
ggtcttatagacttttgcaaaggtgtaaagccgtttcctccgggacattattataaagac
ggtgagtttcacagttacaatgacatagctgatcccaaagtaatagttgatgaagaaata
gaaaccataacaaaaaagataaaggacaaactggaagctgcagtgataaaaaggcttcac
tctgatgcacctataggctttcttttgagcggggggctggattcgtcgctggtgtgtgca
atagcacagaagcatctgaaaaaaccgataaaaacttttgctataggtatggaaacagat
ccgatagacttgaagtacgcaggagaagtggcagaatatcttggaacggagcatacggag
gtaagaattgccaaagatgatgtcttgggagcgttaagagatgtaatatatcatcttgaa
agctgggatataacaacagtaagggcaagtattggaatgtatcttatatgtaaatatata
catgaaaatacaggtttaaaggttctgctgacaggagaagtaagtgacgaaatttttgga
tataaatatacagactttgctccaacacctgcagagtttcaaaaagaagcacagaaaagg
atcagggagctttatttatatgatgtattacgggcagacagatgtattgctgcacattca
ctggaagcaagagtgcctttcggggatattgattttgtaaattatgtaatgagtgtaaat
cctgaaaagaaaatgaacaagtataataaaggaaagtaccttttaagaaaagcttttgaa
ggggagggatatcttccagacagtatactttacagagagaaagcagcttttagcgatgct
gtgggacattctatggttgattatctgaaagaatatgccgaagcgaagtattcggaggaa
gatttgaaaaatgctgcggataaatatccttacaaaacaccatttacgaaagagtcactt
ttatacagagagatttttgaagaattttatccgggaaatgcagactggataaaagatttc
tggatgcctaaccgggaatgggaagggtgcagagttgacgatcccagtgcaagagttctg
tcaaactacggagacagcggaaaataa

DBGET integrated database retrieval system