KEGG   Sebaldella termitidis: Sterm_0384Help
Entry
Sterm_0384        CDS       T01123                                 

Definition
(GenBank) UDP-N-acetylmuramyl-tripeptide synthetase
  KO
K01928  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
str  Sebaldella termitidis
Pathway
str00300  Lysine biosynthesis
str00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:str00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Sterm_0384
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Sterm_0384
Enzymes [BR:str01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     Sterm_0384
Peptidoglycan biosynthesis and degradation proteins [BR:str01011]
 Precursor biosynthesis
  Amino acid ligase
   Sterm_0384
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C Mur_ligase
Motif
Other DBs
NCBI-ProteinID: ACZ07268
JGI: Sterm_0384
UniProt: D1AM00
Position
439450..440895
Genome map
AA seq 481 aa AA seqDB search
MFEIFENVEYEVINKGKDFVIGDIHYDSRKIKENDVFCALIGAVTDGHNYIEKAVNSGAK
MVIAEKKDITVADKDVTYIFVDNLRKHLGVIASNFFGWPQKKLKIIGITGTNGKTTSSYI
LDSMLENTSRIGTIGYKILDEEIEAPNTTPESLDLVKMLDKSLKKGVEYFIMEVSSHALE
IGRVDMLEFDSVMFTNLTQDHLDYHENMENYFNAKFKLFSMLRNKDAAAVNIDDSYGERI
YNSNKSYKSYSIIKDSDLKGKIEEYHNGGMKASVIFQGAEYFFDTKLVGDYNLYNLLGCI
GVLLNLGFDIRDIIERVKRVGYVPGRFELVNEGQDFRVIVDYAHTDNGLENILETVRKIT
EKRVITIFGAGGDRDNTKRPKMARAAAKYSDFVIITSDNPRTEDPAEITRQVEKGLTDID
FPKDKYTVIVDREQAIRYGIEMSDANDSLLIAGKGHEDYQILGREKIHFDDREQARKYLK
K
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgttcgaaatatttgaaaatgtagaatatgaagttatcaataaaggaaaagactttgtc
ataggggatattcattatgactccagaaagataaaggaaaatgatgtgttttgtgctctt
ataggagcagtcacagacgggcataactatatagaaaaggccgtgaacagcggtgctaaa
atggtaatcgcggaaaaaaaggatattactgttgctgataaggatgtaacctacattttt
gtggataatctaagaaaacatcttggggtaatagcttccaattttttcggctggcctcag
aagaaactgaaaataataggtattacagggacaaacggtaaaactacatcaagctacata
ctggacagtatgcttgagaatacatcaagaataggaactataggctataaaatactggat
gaggaaatagaagcaccgaacactactcccgaatcacttgatctggtaaaaatgctggat
aagagcctgaaaaaaggtgtggagtattttataatggaagtaagctcacatgctttggag
ataggacgggtggatatgcttgaatttgattcggtaatgtttactaatcttacgcaggat
catctggattatcatgaaaatatggagaattattttaacgctaagtttaagctgttttcc
atgctcagaaataaagatgctgcagctgtaaatatagatgattcctacggggaaagaatt
tataattccaataaaagctataaatcttattctataataaaggattcggatctgaaagga
aaaatagaggaatatcataacggaggaatgaaagcttctgttatttttcagggagcggaa
tatttctttgatacgaagctcgtgggagactataatctgtataatcttctgggttgtatc
ggagtgcttctgaatctcggttttgatatcagggatataatcgaaagggtgaaaagagta
ggttatgtaccgggaagattcgagctggtaaatgaaggacaggatttcagagtaatagtg
gactatgcacatacagacaacggacttgaaaatatactggaaactgtgagaaaaataact
gaaaagagagtaataacaatattcggggcaggcggagacagagataataccaaaagacca
aagatggcaagggcagctgcaaagtacagcgactttgtaattataacttctgataatccc
agaaccgaagatccggcagaaataacaaggcaggtagaaaaaggactcacagatatagat
tttccaaaagataaatatacagtaattgtagacagggaacaggcaataagatatggaata
gaaatgtcagatgccaacgacagccttcttatagcaggtaaagggcatgaagattatcaa
atactagggcgtgaaaagatccattttgatgacagggaacaagccagaaaatatttgaag
aaataa

DBGET integrated database retrieval system