KEGG   Sebaldella termitidis: Sterm_0601Help
Entry
Sterm_0601        CDS       T01123                                 

Definition
phosphoglycerate mutase (EC:5.4.2.4)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
str  Sebaldella termitidis
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:str00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sterm_0601
   01230 Biosynthesis of amino acids
    Sterm_0601
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sterm_0601
  Energy metabolism
   00680 Methane metabolism
    Sterm_0601
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sterm_0601
Enzymes [BR:str01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Sterm_0601
Exosome [BR:str04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Sterm_0601
  Exosomal proteins of melanoma cells
   Sterm_0601
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(651971..652660)
Genome map
AA seq 229 aa AA seqDB search
MYLVFIRHGQSEWNKKNLFTGWTDVDLSDEGINEAIKAGQLLKKHNFTFDVAYTSVLKRA
IRTLYFVLNETDQLWIPVYKSWRLNERHYGALQGLNKAQTAEKYGDEQVHIWRRSYDVLP
PLLDENDERQSKFDRRYEGLDSRILPSGENLKVTLERVMPYWEDEIAPALKSGKKVVIAA
HGNSLRALAKYLENISDDEIMDLEIPTGVPLIYELDDNFKVLKKYYLED
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgtatttagtttttattcgtcatggtcaaagtgagtggaataaaaagaatcttttcaca
ggctggactgacgttgatttatccgatgaaggtataaatgaagctattaaagccggacag
ctgctaaaaaaacacaattttacttttgacgtggcttacacttctgttttaaaaagagca
attcgaacactttactttgttttaaatgaaactgaccagctgtggataccggtttataaa
tcatggcgtctgaatgaaagacactacggagctcttcaggggcttaataaggctcagaca
gcggaaaaatacggtgacgagcaggttcatatatggcgtcgaagttatgatgtactccct
ccgcttttagacgaaaatgatgaaagacagtcaaaatttgacaggagatatgaaggattg
gattcccgtattttaccttcaggagaaaatctgaaagtaacccttgaaagagtgatgcct
tactgggaagacgaaattgcccctgcactgaaatcaggaaaaaaagtagttattgcagcg
catggaaacagtcttcgtgccttggcaaagtatctcgagaatataagcgatgacgagatc
atggatttggaaatacctacaggtgttcctcttatttatgaacttgatgataattttaaa
gttttgaaaaaatattaccttgaagattaa

DBGET integrated database retrieval system