KEGG   Sebaldella termitidis: Sterm_0715Help
Entry
Sterm_0715        CDS       T01123                                 

Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K12111  
evolved beta-galactosidase subunit alpha [EC:3.2.1.23]
Organism
str  Sebaldella termitidis
Pathway
Galactose metabolism
Other glycan degradation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:str00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Sterm_0715
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Sterm_0715
Enzymes [BR:str01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Sterm_0715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(768444..771518)
Genome map
AA seq 1024 aa AA seqDB search
MKIWENININNINRLKQRADFRLYDNINAAIDNRRKKNSKNLNGVWKFLFLDAPEYSPEG
FFEKSFDTSDWDNITVPGNWQMQGYGKMHYSDLWYNFPINPPYVPSLNPTGIYKRTFSIP
DSWKNERIILKFHGVDSAFHIYLNGKEIGYSKGARYEAEFDITDHIVRNSENDLTVRVYQ
WSDGTYLEDQDMWWLSGIFRDVEIYAEPFDCIDDIFVTTDLDENYTDSVLNVSVSFRGNV
LGCTVNYLLLDDQDNEILNIENNLNSNFDNISEKIANPKKWSAETPYLYTFIITLKKEDQ
ILAVAGQKTGFRKIEIKGNTFTVNNVAIKLKGVNRHDYNPANGRVVSREEMEKDIILMKQ
NNINAVRTAHYPNSSCFYDLCDEYGLYVIDEADLECHGFELTEKYDWITDDPVWKSAYID
RLERMMARDKNHPSIIMWSLGNESAFGDNFRAMAEYAKKNDPTRLVHYEGDFEAEVTDVF
STMYTWLEKNSQTPEVKKVFMKDIALTSKKPHILCEYAHAMGNGPGNFKEYQDLFYEYEH
LQGGFVWEWFDHGIQAYDKNGNSYYKYGGDFGDNPNNGNFCIDGLLMPDRTPSPSLFEYK
KIIEPVKTEAVDLNNGILKLTSRYDFINLNILTMSYSVYEDNRIIKSGSLALDISARDTK
NICIEALKEIKYKDTHDYYLNISYRTNKRTNWSDEGHELAAAQFLLSEKTEFCNKKTDGS
LLVSETQSVLNIYGLDFKCAFDKITGRMLYAEKDGLKILENGPELNFWRAPIDNDMYLLE
DYYKKYFMNLMTENTESFLYNAADNYVEICVKTINGAPNAAWYYKSTYLYKVFADGTILF
DIEGIPSGITAQAPEMIPRIGVKLRLNKACENVRWHGKGPGESYPDSKESQLFGFYENNI
DGLFTNYVKPQENGSRSSCSWTRLLNDRGMGLMVYSQDKFDFSARFFEDSDLEYAGHTPD
LKKRDYITLNIDYKQNGLGSNSCGQSQMEKYKCRFEKFSLSLKISLYNNKEINDLDLAGE
KIIF
NT seq 3075 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatatgggaaaacataaatataaacaatataaacagactaaagcaaagagctgat
ttcagactttacgataatattaatgctgccattgacaacagaagaaaaaaaaattccaaa
aatctgaacggagtatggaaatttctctttttagatgcgcctgagtattctcctgaaggc
ttttttgaaaagagctttgacacatcagactgggataatataacagtaccgggaaactgg
cagatgcagggatatggaaaaatgcattattcagatttatggtataactttcctattaat
cctccctatgttccttcattgaatcccacaggtatttataaaagaacattttcaattcct
gattcatggaaaaatgaaagaattatactaaaatttcatggtgtggactctgcatttcat
atttatctgaacggcaaagaaataggctacagcaaaggtgccagatatgaagctgaattt
gatattacagatcatattgtccgaaacagtgaaaacgaccttactgtaagagtttatcaa
tggtcggacggaacttacctagaagatcaggatatgtggtggctgagcggtattttcaga
gatgtggagatatatgccgagccttttgactgtattgacgatatctttgttactactgat
cttgatgaaaattatactgactctgtgctgaatgtttctgtcagcttcaggggaaatgta
ctgggctgtaccgtaaattatctgcttcttgatgatcaggataatgaaatacttaatatt
gaaaataatctaaacagtaattttgataatataagtgaaaaaatagcaaatccgaaaaaa
tggtctgctgaaactccatatctttatactttcatcattacactaaagaaagaggatcag
attctggcagttgccggacaaaagaccggatttagaaaaattgaaatcaaaggcaatacc
ttcactgttaataatgtagcaataaagctcaaaggcgttaacagacacgattataatcct
gcaaacggacgtgttgtttcaagagaagagatggaaaaagatattattctgatgaaacaa
aataatataaacgcagtaagaacagcacattaccctaactcttcctgcttttatgactta
tgcgacgaatacggtctttatgtaatcgacgaagctgatcttgaatgtcatggttttgag
cttacggaaaaatatgactggattactgatgatcctgtctggaaaagtgcttatatcgac
agactggaaagaatgatggcaagggataaaaatcacccttcgataattatgtggtctctg
ggaaatgagtcagccttcggagataatttcagagctatggcagaatatgctaagaaaaat
gaccccacaaggcttgtccattatgaaggtgattttgaagcagaagtaactgatgttttt
tctactatgtatacgtggcttgaaaaaaattcccagacacctgaggtaaagaaagttttt
atgaaagatatagctcttacatccaaaaagcctcacattctctgtgaatatgcccatgcg
atggggaacggaccgggaaatttcaaggaatatcaggatttgttttatgaatacgagcat
ctgcaggggggatttgtatgggaatggtttgatcacgggattcaggcttatgataaaaat
ggaaactcttattataagtatggcggagatttcggagacaatcctaataatggtaatttt
tgtatcgacggattattgatgcctgacagaactccgtcaccaagtctttttgaatataaa
aagattatagagccggtaaaaacagaggctgttgatctgaataacggaattctgaaactg
acaagccgttatgattttattaatcttaatattcttactatgtcttacagtgtttacgag
gataacaggatcataaaaagcggcagtctggctctcgatatctcagccagagatacaaaa
aatatctgtatagaagcgttaaaagagatcaaatataaagatacacatgactattatctt
aatatctcatacagaacaaacaaacgcactaactggtctgacgagggacacgagctggct
gcggcacagtttttgcttagtgaaaaaacagaattctgcaataagaaaacggatggttcc
cttttagtatcagaaacacagtcagtactaaatatttacggtcttgattttaaatgtgca
tttgataaaattaccggaagaatgctgtatgcagaaaaagacggattaaaaattctggaa
aacgggcctgaattaaatttttggcgtgctcctattgataatgatatgtatcttctcgag
gattattataaaaagtattttatgaaccttatgacagaaaatactgaaagcttcctgtat
aatgctgctgataattatgtggagatatgtgtaaagacaataaatggagcgcctaatgcc
gcctggtattataaaagtacatatctgtataaggttttcgctgacggaacaatattattt
gacattgagggaattccttcggggattacagctcaggcacctgaaatgatcccgcgtatc
ggtgtaaagctcagattaaataaagcctgtgaaaatgtgagatggcacgggaaaggaccc
ggagagtcttatcctgattcaaaagaatcacaattattcggcttctatgaaaataatata
gacggactttttacaaactatgtaaaaccgcaggaaaacggcagcagaagcagctgcagc
tggacaagactgcttaatgacagaggtatgggacttatggtttactctcaggataaattt
gactttagtgcaagattttttgaagactctgatcttgaatatgcgggacacacgcctgat
ctaaaaaagagagattatatcactctgaatatcgattacaaacaaaacggccttggttcc
aattcatgcggacagtcccagatggaaaaatataagtgcaggtttgaaaaattcagttta
tctctgaaaatttcattatataataacaaagaaataaacgatctggatttagccggagaa
aaaattattttttaa

DBGET integrated database retrieval system