KEGG   Sebaldella termitidis: Sterm_1026Help
Entry
Sterm_1026        CDS       T01123                                 

Definition
(GenBank) Phosphoglycerate mutase
Organism
str  Sebaldella termitidis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1111523..1112161
Genome map
AA seq 212 aa AA seqDB search
MCKDEQLNIYFVRHGETLWNKEEKIQGELDSPLTLNGIEDIQKLAENLGQIKFDEVYSSE
LGRAYETALILSNGRHRIKRMKEFNEKNFGDWQGMEIKEIYRKYPVQAEFYFNDIKNYNS
KEINAESLEHALRRFVSGVKKIEKSVRNGNVLVVSHGTILKLFFNYIDNKDINELNEKDL
MENTSFRVLQYCGRNMVQNSRPAEKILSSNKT
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgtgtaaagacgaacagctgaacatatactttgtgagacatggtgaaactctttggaac
aaagaggagaaaattcagggtgagctggattcgcctctgacactcaatggaatagaagat
atacaaaagcttgcggaaaatctcggacagataaaatttgacgaagtctacagcagtgag
ctgggaagagcatatgaaacagctttgatattaagtaacggcagacacagaataaagcgc
atgaaagaatttaatgaaaaaaatttcggagactggcagggaatggaaatcaaggaaatt
tacagaaaataccctgtacaggcagaattttattttaatgatataaaaaattataacagc
aaggagataaatgctgaaagtctggagcatgcactgagaagatttgtctcgggagtaaaa
aaaatagaaaagtccgtaagaaatggaaatgtgctggtagtatcacacgggacgatcctg
aagcttttctttaattatattgataataaagacataaatgagctgaacgaaaaagatctt
atggaaaatacgagctttagggtattgcagtactgcggaagaaatatggttcagaattcc
cgaccggcagagaaaatattaagcagtaataagacatga

DBGET integrated database retrieval system