KEGG   Sebaldella termitidis: Sterm_1027Help
Entry
Sterm_1027        CDS       T01123                                 

Definition
(GenBank) Porphobilinogen synthase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
str  Sebaldella termitidis
Pathway
str00860  Porphyrin and chlorophyll metabolism
str01100  Metabolic pathways
str01110  Biosynthesis of secondary metabolites
str01120  Microbial metabolism in diverse environments
Module
str_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:str00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Sterm_1027
Enzymes [BR:str01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Sterm_1027
Exosome [BR:str04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Sterm_1027
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD MTHFR PTS_IIB
Motif
Other DBs
NCBI-ProteinID: ACZ07895
JGI: Sterm_1027
UniProt: D1AFL0
Position
1112187..1113164
Genome map
AA seq 325 aa AA seqDB search
MFKRHRRLRVNKNMRNLVRDVYLDADDLVYPLFIEEGTDIKSEIPSMPGIYRYSVDRLKE
ELDEVQSLGIKTLLLFGIPKHKDNTASEAYNEHGIVQEAVRYIKKEYPDFLVITDVCNCE
YTDHGHCGILDENGYVLNDVTLELLGKTAVSHAKAGADIIAPSDMMDGRIEKIREELDKN
GFENIPVMSYAVKFSSAFYGPFRDAADSAPKFGDRKSYQMDYRAEFDVLSEACEDIKQGA
DMIIVKPALAYLDLIAKIKRECNVPIVAYSVSGEYSMVKAAAQNGWIDEKGVVMEKIYAM
KRAGAGIIITYYAKDIAEWLREEKK
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaaagacacagaaggctcagagtaaataaaaatatgagaaatctggtaagagat
gtgtatctggatgcggatgaccttgtatatccgctgtttatagaagaaggaactgatata
aaaagtgagattccttctatgcccggtatatacagatattctgtggacaggctgaaagag
gagcttgacgaggtacagtctttgggaataaagacgcttctccttttcggaattccaaag
cataaggataatactgcaagcgaagcatataatgagcatggaatagtacaggaggctgta
aggtatataaaaaaagaatatcctgattttcttgtaataacagatgtatgcaactgtgag
tatacagatcacgggcattgcggaatactggacgaaaatggttatgtattaaatgatgta
acactggagcttctggggaaaacagcagtttctcatgctaaggcaggtgcggatatcata
gctccttcggatatgatggacggaagaatagagaaaataagagaagagctggataaaaac
ggttttgaaaatatacctgtaatgtcttatgcagtaaagttttcatcggctttttacgga
ccgttcagagatgcagcagattcagcgccgaaatttggtgacagaaaatcctatcagatg
gattacagggcagaatttgacgtgttaagcgaagcctgcgaggatataaagcagggagca
gatatgataatagtaaagcctgctctggcataccttgatttaatcgcaaaaataaaaaga
gaatgtaatgtacctatagtggcatacagcgtgagcggtgagtattcaatggtaaaggca
gcggcacaaaacggctggatagatgaaaaaggcgtggtaatggaaaagatatatgctatg
aagagggcaggggcaggtattataattacatattatgcaaaagacatagcagaatggctc
agagaggaaaaaaaatga

DBGET integrated database retrieval system